PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.18637s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 267aa    MW: 30671.4 Da    PI: 9.0705
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.18637s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.2e-51181431128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhP+d+elv++yL +++ ++  +   v+ +vd++k+ePwd+p++++ + kewyf+s++d+ky+tg+r+nrat++gyWkatgkd
  Araha.18637s0005.1.p  18 LPPGFRFHPRDDELVCDYLMRRTVRSLYQP-VVLIDVDLNKCEPWDIPQMARVGGKEWYFYSQKDRKYTTGHRANRATATGYWKATGKD 105
                           79*****************99977777555.5899*************9888999********************************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +++ + +g+lvg++ktLvfy+grapkg+ktdWvmhe+rl
  Araha.18637s0005.1.p 106 RAIQR-NGSLVGMRKTLVFYRGRAPKGRKTDWVMHEFRL 143
                           ***99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5910168IPR003441NAC domain
PROSITE profilePS5100555.87618167IPR003441NAC domain
PfamPF023651.5E-2519143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEEKEEKKGS ISMVEANLPP GFRFHPRDDE LVCDYLMRRT VRSLYQPVVL IDVDLNKCEP  60
WDIPQMARVG GKEWYFYSQK DRKYTTGHRA NRATATGYWK ATGKDRAIQR NGSLVGMRKT  120
LVFYRGRAPK GRKTDWVMHE FRLQETLLHH TSNSLKEEWV LCRVFHKNSN GPDRDDNTKS  180
SSNETASAFM DSYINFDHHI INQHVPCFSN NLSENQTNES GLVSKNSTPL FNASPDQMIL  240
RTLLSQLTKK VEKSESYGEG SSERAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-521317112169NO APICAL MERISTEM PROTEIN
1ut4_B1e-521317112169NO APICAL MERISTEM PROTEIN
1ut7_A1e-521317112169NO APICAL MERISTEM PROTEIN
1ut7_B1e-521317112169NO APICAL MERISTEM PROTEIN
3swm_A1e-521317115172NAC domain-containing protein 19
3swm_B1e-521317115172NAC domain-containing protein 19
3swm_C1e-521317115172NAC domain-containing protein 19
3swm_D1e-521317115172NAC domain-containing protein 19
3swp_A1e-521317115172NAC domain-containing protein 19
3swp_B1e-521317115172NAC domain-containing protein 19
3swp_C1e-521317115172NAC domain-containing protein 19
3swp_D1e-521317115172NAC domain-containing protein 19
4dul_A1e-521317112169NAC domain-containing protein 19
4dul_B1e-521317112169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.18637s0005.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266451e-116AB026645.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGH6.
GenBankCP0026861e-116CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882799.10.0NAC domain-containing protein 21/22
SwissprotQ84TE61e-121NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLD7L0M30.0D7L0M3_ARALL; DNA binding protein
STRINGscaffold_301478.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36192859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12977.11e-172NAC family protein
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]