PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.17573s0003.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 485aa    MW: 54553.5 Da    PI: 8.5226
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.17573s0003.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.41.2e-132099996
                          HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                    B3  9 dvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                          +v+ks+  ++p +f++++ + k++s++l+l++    r+Wevkl  ++++    +++GWk+F   + L++ D+++F+ +g+++f  +v++
  Araha.17573s0003.2.p 20 HVHKSS-PMIPAEFFSTYVEGKNQSTKLKLTSdALDRTWEVKL--NGRR----FAGGWKNFSTVHSLQDDDVLIFREIGDMTF--HVTA 99
                          666666.89*********55567999***9996778*******..8887....99*********************8898888..6665 PP

2B3681.3e-21153245498
                           E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                    B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                           + ++s++l+++rl+l k fa+++g+++++  ++ l++++g+sW++ l+y+ + ++  +++GW++F+  ngL++g f  Fk+++ +++++
  Araha.17573s0003.2.p 153 AHVTSSNLSRDRLCLIKAFARSNGLNERCC-EIELMNQHGKSWTLGLRYNSSNDQASISGGWRDFCLVNGLEAGSFYWFKFVR-NGARP 239
                           5689**********************8775.*************************************************998.78889 PP

                           EEEEE- CS
                    B3  93 vvkvfr 98 
                           ++++++
  Araha.17573s0003.2.p 240 LLRLCS 245
                           999987 PP

3B373.13.4e-23273370199
                           EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                           f++ + ++++lksg+l l+++fa e+++k++e  ++tl d++g  W  ++   ++++g+y+l+kGW++F+ an+Lk+g+++++++++ +
  Araha.17573s0003.2.p 273 FLTMTFKPYMLKSGQLHLSRPFAIENEIKEAE--DITLVDKNGGNWPSYVASgDGRGGKYYLAKGWRSFCAANRLKTGETFTLEFVRGE 359
                           66777899******************999777..7***************766888888***************************99* PP

                           EE..EEEEE-S CS
                    B3  89 efelvvkvfrk 99 
                           ++++++k+++k
  Araha.17573s0003.2.p 360 GTTPMLKFCSK 370
                           *********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.88E-167105IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-158103IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.01111103IPR003340B3 DNA binding domain
CDDcd100171.95E-111398No hitNo description
SMARTSM010191.6E-1614103IPR003340B3 DNA binding domain
PfamPF023626.0E-82097IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-20143245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-20146247IPR015300DNA-binding pseudobarrel domain
CDDcd100172.08E-19150245No hitNo description
SMARTSM010193.3E-27150247IPR003340B3 DNA binding domain
PROSITE profilePS5086313.874150247IPR003340B3 DNA binding domain
PfamPF023622.1E-19153245IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-17267370IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-18272370IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.41273370IPR003340B3 DNA binding domain
CDDcd100174.89E-16273361No hitNo description
SMARTSM010193.2E-28273371IPR003340B3 DNA binding domain
PfamPF023621.9E-21273370IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MDDPVISSPT KQHFFVIVLH VHKSSPMIPA EFFSTYVEGK NQSTKLKLTS DALDRTWEVK  60
LNGRRFAGGW KNFSTVHSLQ DDDVLIFREI GDMTFHVTAS GRSFCKVQYI SSAENGADEV  120
DAWNEYSDSK NIASKKKPRT EAESSSKNSY LVAHVTSSNL SRDRLCLIKA FARSNGLNER  180
CCEIELMNQH GKSWTLGLRY NSSNDQASIS GGWRDFCLVN GLEAGSFYWF KFVRNGARPL  240
LRLCSDTIPE EDCYKGNRKD NLSESASMKQ SKFLTMTFKP YMLKSGQLHL SRPFAIENEI  300
KEAEDITLVD KNGGNWPSYV ASGDGRGGKY YLAKGWRSFC AANRLKTGET FTLEFVRGEG  360
TTPMLKFCSK TKIEQVPLGE ERETQEETET RVEKRARVSA EGGSSRRNQA SNKPNADPQN  420
LQPRQPPCSI SDRVQKVKQI IEDTLTGVKR IRSELEVKEQ NLEASILEID ALGEKVLEIN  480
KILK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937130.0AB493713.1 Arabidopsis thaliana At4g31615 mRNA for hypothetical protein, partial cds, clone: RAAt4g31615.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_680753.20.0transcriptional factor B3 family protein
SwissprotQ3E9T20.0REM2_ARATH; B3 domain-containing protein REM2
TrEMBLD7MB450.0D7MB45_ARALL; Putative uncharacterized protein
STRINGAT4G31615.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31615.10.0B3 family protein