PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.17573s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 443aa    MW: 50157.9 Da    PI: 5.7575
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.17573s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.72.1e-1888183198
                           EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                           f+++ ++ ++l ++rl l+++f+  +gg++ ++ ++ + +e+gr+W++kl  + +sg +++++GW +F+  ngL +g  + Fkl + ++
  Araha.17573s0001.1.p  88 FITACVTRYSLLHDRLDLSRNFTLLFGGNQ-KTCEIDVVNEQGRRWTMKLAKNISSGVFYIRQGWGNFCCVNGLSQGQLCKFKLFQ-NG 174
                           67788999***************8886664.4459***************99999999*************************988.56 PP

                           E..EEEEE- CS
                    B3  90 felvvkvfr 98 
                           +++v+ ++ 
  Araha.17573s0001.1.p 175 ERPVLWLCP 183
                           667877775 PP

2B368.68.5e-22211310199
                           EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy....rkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                           f+ v  +++  ++g+l+lp +f+++++++k++  +++l +++gr+W+  l++    r++s++++l++GW+e+++ang+k++D++ ++l+
  Araha.17573s0001.1.p 211 FLIVKYTPSRDTTGQLSLPVSFTRKNNINKAG--EVILLNQDGRKWSSFLQItglgRGGSEWFYLRRGWREMCEANGVKVNDSFKLELM 297
                           55667789999999*************99887..7***************8889999999***************************** PP

                           SSSEE..EEEEE-S CS
                    B3  86 grsefelvvkvfrk 99 
                           + +++++++k+++k
  Araha.17573s0001.1.p 298 W-EGANPMFKFCSK 310
                           *.9999******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.7E-1582184IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.0E-2388185IPR003340B3 DNA binding domain
PROSITE profilePS5086312.84488184IPR003340B3 DNA binding domain
PfamPF023621.5E-1688183IPR003340B3 DNA binding domain
SuperFamilySSF1019361.08E-1690185IPR015300DNA-binding pseudobarrel domain
CDDcd100171.85E-16100183No hitNo description
Gene3DG3DSA:2.40.330.101.4E-18205310IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-19208315IPR015300DNA-binding pseudobarrel domain
CDDcd100172.47E-16210309No hitNo description
SMARTSM010195.0E-24211311IPR003340B3 DNA binding domain
PROSITE profilePS5086312.816211310IPR003340B3 DNA binding domain
PfamPF023621.5E-22211310IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
GDVLVFKHHG DEVFHVSVSG DIQNASSSHV DTEDTYIDDE DLDIDDDDYG EDDDDDVDDD  60
EGEDNLENIS EKTNKKQEAD SSSEHSGFIT ACVTRYSLLH DRLDLSRNFT LLFGGNQKTC  120
EIDVVNEQGR RWTMKLAKNI SSGVFYIRQG WGNFCCVNGL SQGQLCKFKL FQNGERPVLW  180
LCPQESGNGR KEKRTFDEVS KVKEKKTPSP FLIVKYTPSR DTTGQLSLPV SFTRKNNINK  240
AGEVILLNQD GRKWSSFLQI TGLGRGGSEW FYLRRGWREM CEANGVKVND SFKLELMWEG  300
ANPMFKFCSK IENHEYKGKG NQRTRKKRAC ETDPQPRKVK KTPRVGVEGP EHQVDEERGR  360
TQVSNRTNTI SRELQRLLPR SCSVSDQVAN VKQGIVDTLN TVRQCRTELE TSEQNLQASL  420
LAIEALGERI WGISKILSNN LV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00602PBMTransfer from AT4G31610Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0050020.0BT005002.1 Arabidopsis thaliana clone U20619 unknown protein (At4g31610) mRNA, complete cds.
GenBankBT0038910.0BT003891.1 Arabidopsis thaliana clone RAFL15-10-H22 (R20619) unknown protein (At4g31610) mRNA, complete cds.
GenBankAF3363440.0AF336344.1 Arabidopsis thaliana reproductive meristem protein 1 (REM1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002869319.10.0hypothetical protein ARALYDRAFT_491577
SwissprotQ84J390.0REM1_ARATH; B3 domain-containing protein REM1
TrEMBLD7MB480.0D7MB48_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.7__1010__AT4G31610.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99501736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31610.10.0B3 family protein