PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.16225s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 366aa    MW: 42425.4 Da    PI: 5.234
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.16225s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.8e-5591381129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkat
  Araha.16225s0003.1.p   9 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLQEqcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKAT 96 
                           69****************************.9***************953432233667****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           g+dk+v++ k++l+g++ktLv+ykgrap+g+k+dW+mheyrle
  Araha.16225s0003.1.p  97 GRDKAVYD-KTKLIGMRKTLVYYKGRAPNGQKSDWIMHEYRLE 138
                           ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-603158IPR003441NAC domain
PROSITE profilePS5100558.8649158IPR003441NAC domain
PfamPF023651.4E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MESMESCSVP PGFRFHPTDE ELVGYYLRKK IASQKIDLDV IRDIDLYRIE PWDLQEQCRI  60
GYEEQNEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK AVYDKTKLIG MRKTLVYYKG  120
RAPNGQKSDW IMHEYRLESD ENAPPQEEGW VVCRAFKKRA TGQAKNTETW TSSYFYDEVA  180
SNGVNSFTDP IDYISKQQHK LFGKGLMCKQ ELEGMVDGLN YMQSNQFIQL PQLQSPSLPL  240
MKRPSSSMSI TSMDNHCNYK TPSEDEESFE SLISRENKRK KKKQVMMTGD WRELDKFVAS  300
QLMSQEDNGT SGFAGHHIAN EDKNNNDVEI DSSMFLSERE EENRFISEFL STNSDYDIGI  360
CVFDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-49216310170NO APICAL MERISTEM PROTEIN
1ut4_B2e-49216310170NO APICAL MERISTEM PROTEIN
1ut7_A2e-49216310170NO APICAL MERISTEM PROTEIN
1ut7_B2e-49216310170NO APICAL MERISTEM PROTEIN
3swm_A2e-49216313173NAC domain-containing protein 19
3swm_B2e-49216313173NAC domain-containing protein 19
3swm_C2e-49216313173NAC domain-containing protein 19
3swm_D2e-49216313173NAC domain-containing protein 19
3swp_A2e-49216313173NAC domain-containing protein 19
3swp_B2e-49216313173NAC domain-containing protein 19
3swp_C2e-49216313173NAC domain-containing protein 19
3swp_D2e-49216313173NAC domain-containing protein 19
4dul_A2e-49216310170NAC domain-containing protein 19
4dul_B2e-49216310170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.16225s0003.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0062010.0AC006201.4 Arabidopsis thaliana chromosome 2 clone T27K22 map c245, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886145.10.0NAC domain-containing protein 37
SwissprotQ9SL410.0NAC37_ARATH; NAC domain-containing protein 37
TrEMBLD7LAF10.0D7LAF1_ARALL; Predicted protein
STRINGAl_scaffold_0003_37720.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36862661
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.10.0vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]