PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.16094s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 470aa    MW: 52470.8 Da    PI: 5.8043
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.16094s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.91.1e-50131411128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lp+G+rF+Ptdeel+ +yL++k++g++ ++ ++i+e+di+k+ePwdLp  + +k++++ew fF++ d+ky++g+r+nrat +gyWkatg
  Araha.16094s0001.1.p  13 LPVGLRFRPTDEELIRYYLRRKINGHDDDV-KAIREIDICKWEPWDLPdfSVIKTKDSEWLFFCPLDRKYPNGSRQNRATVAGYWKATG 100
                           799************************999.89***************6448889999******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd++++s k++ +g+k+tLvf+ grap+g++t+Wv+heyr+
  Araha.16094s0001.1.p 101 KDRKIKSGKTNIIGVKRTLVFHAGRAPRGTRTNWVIHEYRA 141
                           *******9999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-578164IPR003441NAC domain
PROSITE profilePS5100554.74113164IPR003441NAC domain
PfamPF023651.9E-2414140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MNQNLQVLSM DSLPVGLRFR PTDEELIRYY LRRKINGHDD DVKAIREIDI CKWEPWDLPD  60
FSVIKTKDSE WLFFCPLDRK YPNGSRQNRA TVAGYWKATG KDRKIKSGKT NIIGVKRTLV  120
FHAGRAPRGT RTNWVIHEYR ATEDDLSGTN PGQNPFVICK LFKKQELNLA EEDSKSDEVE  180
EPAVSSPTVE VSKSEVSEVT KTEDVKRLDV AESSLVISGD SHSDACDEAT TAELVDFDWY  240
PELESLDYTL FSPLHSQVQS ELGSSYNTFQ PGSSNFSGNN NNSFQIQTQY GTNEVDTYIS  300
EFLDSILKSP DEDPEKHKYV LQSGFDGAAP DQIAPVYQQG SAVNMSNDVS VTGIKIKSRQ  360
AQSSGCTNDY IAQGNGPRRL RLQSNLNGIN SKNPELQAIK REAEDTVGET LKKGCGKLKR  420
SKNVTDFVFK KIMSVKCSYR GLFRAAVVAV VFLMSVCSLT VDFRASAMP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-4731657166NO APICAL MERISTEM PROTEIN
1ut4_B4e-4731657166NO APICAL MERISTEM PROTEIN
1ut7_A4e-4731657166NO APICAL MERISTEM PROTEIN
1ut7_B4e-4731657166NO APICAL MERISTEM PROTEIN
3swm_A6e-47316510169NAC domain-containing protein 19
3swm_B6e-47316510169NAC domain-containing protein 19
3swm_C6e-47316510169NAC domain-containing protein 19
3swm_D6e-47316510169NAC domain-containing protein 19
3swp_A6e-47316510169NAC domain-containing protein 19
3swp_B6e-47316510169NAC domain-containing protein 19
3swp_C6e-47316510169NAC domain-containing protein 19
3swp_D6e-47316510169NAC domain-containing protein 19
4dul_A4e-4731657166NAC domain-containing protein 19
4dul_B4e-4731657166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:20156199, PubMed:19947982). Transcriptional activator involved in response to cold stress. Mediates induction of pathogenesis-related (PR) genes independently of salicylic signaling in response to cold. Binds directly to the PR gene promoters and enhances plant resistance to pathogen infection, incorporating cold signals into pathogen resistance responses (PubMed:19947982). Plays a regulatory role in abscisic acid (ABA)-mediated drought-resistance response (PubMed:22967043). {ECO:0000269|PubMed:19947982, ECO:0000269|PubMed:20156199, ECO:0000269|PubMed:22967043}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.16094s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt, drought stress, abscisic acid (ABA), salicylic acid (SA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597340.0AY059734.1 Arabidopsis thaliana putative NAC2 protein (At3g49530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002877683.10.0NAC domain-containing protein 62
SwissprotQ9SCK60.0NAC62_ARATH; NAC domain-containing protein 62
TrEMBLD7LSJ80.0D7LSJ8_ARALL; ANAC062
STRINGscaffold_501948.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.10.0NAC domain containing protein 62
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]