PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.16028s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 305aa    MW: 35974.3 Da    PI: 8.6883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.16028s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM45.23e-14812010128
                   NAM  10 tdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                           +de ++++yLk+++ + +   +++i+++++++ +P      +  +++++ f + + +++a gk      +sg W+  g+dk ++sk +g
  Araha.16028s0003.1.p   8 KDEVIISRYLKRRIVNGDSWPANFIEDANVFNKNPYVE---F--DSDSTSFVIVKPRTEACGKTDG--CESGCWRIIGRDKLIKSKaTG 89 
                           69999********87777555499***********632...2..3344556666666666665444..479**************9888 PP

                   NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                           +  g kk+L f k+++p+  k +Wvm+ey+l
  Araha.16028s0003.1.p  90 KILGFKKILKFCKKTKPREYKRSWVMEEYTL 120
                           89***************************98 PP

2NAM26.12.4e-0818029018128
                   NAM  18 yLkkkvegkkleleevikevdiykvePwdLpkkvkaeek.ewyfFskrdkkyatgkrknr.atksgyWkatgkdkevlskkgelvglkk 104
                           y  k ++++ ++      + ++y ++P +L    +  ek + +  +  ++k    + + r + + gyWk   +d+++++ k  ++g k+
  Araha.16028s0003.1.p 180 YCVKIMSSEGNDW-PSYVTNNVYCLHPLELV-DPED-EKfQRFGICIFANK----TYAIRdKCNGGYWKILHHDRPIKE-KFGTIGYKR 260
                           4444444444444.33555689999999995.2222.22233333322222....2233335789*************9.7779***** PP

                   NAM 105 tLvfy......kgrapkgektdWvmheyrl 128
                           ++ f         r+ k +k +W+++eyrl
  Araha.16028s0003.1.p 261 VFEFCetekegYVRNGKDVKLTWTIEEYRL 290
                           *****665532247777789********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.341138IPR003441NAC domain
PfamPF023653.4E-98120IPR003441NAC domain
SuperFamilySSF1019411.44E-268137IPR003441NAC domain
SuperFamilySSF1019417.06E-26149303IPR003441NAC domain
PROSITE profilePS5100517.868163304IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEELLNAKDE VIISRYLKRR IVNGDSWPAN FIEDANVFNK NPYVEFDSDS TSFVIVKPRT  60
EACGKTDGCE SGCWRIIGRD KLIKSKATGK ILGFKKILKF CKKTKPREYK RSWVMEEYTL  120
TNNLNWKQDH VICKIRFIFE AEISFLLTKH FYTTSESLLR NELLPSYGFY SNEQENDEFY  180
CVKIMSSEGN DWPSYVTNNV YCLHPLELVD PEDEKFQRFG ICIFANKTYA IRDKCNGGYW  240
KILHHDRPIK EKFGTIGYKR VFEFCETEKE GYVRNGKDVK LTWTIEEYRL SKNVKRNRFL  300
CVIR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.16028s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888152.10.0NAC domain-containing protein 53
TrEMBLD7KXC20.0D7KXC2_ARALL; Uncharacterized protein
STRINGscaffold_200606.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37041459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G60350.11e-153NAC domain containing protein 24