PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.15483s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 324aa    MW: 37593.7 Da    PI: 6.4027
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.15483s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF337.8e-111150342
                          --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                          i+n++ r+ +f +Rr+g +KK + L +LCd++++ +i+ +
  Araha.15483s0003.1.p 11 ISNDRMRKRSFKQRREGFMKKLNDLKILCDVNACAVIYNP 50
                          9*********************************999965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.75E-19181IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.745149IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-14160IPR002100Transcription factor, MADS-box
CDDcd002668.42E-27285No hitNo description
PRINTSPR004043.8E-5323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-111150IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MARKKLNLTY ISNDRMRKRS FKQRREGFMK KLNDLKILCD VNACAVIYNP FNSNPEVWPS  60
KSEVDNVIKK LKMLTETQKK LKSVNHEEFL NLYISKVEKQ SKKLIVDNKE NCLKEVMFKC  120
LGGNMGDFVM TNNDRLDLCK FIDQYLRNLY HHKNETLNNP NFEIGESSSM DMAPTTTIAN  180
MATTVVDEGM TPPIIPEMSS SSFPNSPLFN SPQLTKQFIV SPNHRLEDVN LASNLFFSDA  240
QNICSPAMNQ FITPSNQGAE HVNFLESNFL PNNNQEVYIP VMDQDEFYYP NQNHNENQQQ  300
RFIDEMMKYD EKTSFPWMVD NHY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.15483s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8306990.0AB830699.1 Arabidopsis halleri subsp. tatrica AGL46, AGL46, AGL46, AGL46, AGL46 gene for agamous-like MADS-box protein AGL46, partial cds, isolate: e067.
GenBankAB8307000.0AB830700.1 Arabidopsis halleri subsp. halleri AGL46, AGL46, AGL46, AGL46, AGL46 gene for agamous-like MADS-box protein AGL46, partial cds, isolate: e068.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020884864.10.0agamous-like MADS-box protein AGL80 isoform X1
TrEMBLS6BCH10.0S6BCH1_ARAHG; Agamous-like MADS-box protein AGL46 (Fragment)
STRINGAT2G28700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.10.0AGAMOUS-like 46