PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1501s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 374aa    MW: 43053.1 Da    PI: 9.2392
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1501s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.63.7e-141151343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         ien+  r++++ k r g+lKK +EL +LC+++++viifs++
  Araha.1501s0003.1.p 11 IENDKSRTTSLQKMRVGLLKKVKELTILCAVRALVIIFSPN 51
                         9**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-17160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.694151IPR002100Transcription factor, MADS-box
CDDcd002661.58E-24285No hitNo description
SuperFamilySSF554555.62E-17294IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-6323IPR002100Transcription factor, MADS-box
PfamPF003198.8E-131152IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MTRKKVKLAW IENDKSRTTS LQKMRVGLLK KVKELTILCA VRALVIIFSP NKAHPTVWPS  60
VEATHGLLCE FFASPRFLQI KKETNVESYI KEKTQKIQEQ LMKSNKKNKE YVINELMMQL  120
QNGRRIADLN LSEMYALLSF SRDTILLCRK KLDFMQFPPL RDPPVFPFET QVEEFKTITN  180
NIFVGGGQDN ERAGKTNEAT RRINVDIFKE SKSYYLFDQW VFPPSPPKPE IYQQIRNENS  240
NPGSYCLYQG SNSNKNPHLE MDPLRLQMMT SHGFVGPVSQ PLQHHNMIDN PVMAMNQPKQ  300
NSFDFMSHEL GINEQGSNIN NSQFYRSNNT TTTNIDGFHQ EPSLNGTTAR ENNVDVATVN  360
INMGWPDFNN HHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.1501s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020885147.10.0uncharacterized protein LOC110229407
TrEMBLA0A178VQF20.0A0A178VQF2_ARATH; AGL48
TrEMBLQ9XEF10.0Q9XEF1_ARATH; AGAMOUS-like 48
STRINGAT2G40210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.10.0AGAMOUS-like 48