PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.14596s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 536aa    MW: 59651.1 Da    PI: 4.8374
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.14596s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1578e-49101351128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           l+pGfrFhPtdeelvv+yLk+k+++kkl++ ++i e+d+yk++P++Lp k  +k+++++w+fFs rd+k+  g+r++rat++gyWkatg
  Araha.14596s0002.1.p  10 LAPGFRFHPTDEELVVYYLKRKIRRKKLRV-DAIGETDVYKFDPEELPeKaLYKTRDRQWFFFSLRDRKH--GSRSSRATDRGYWKATG 95 
                           579***************************.99**************95345667899**********86..89*************** PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd+ +++ ++++vg kktLvf++grap+ge+t+Wvmhey+l
  Araha.14596s0002.1.p  96 KDRVIKC-DSRNVGEKKTLVFHRGRAPNGERTNWVMHEYTL 135
                           *******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-545160IPR003441NAC domain
PROSITE profilePS5100552.72510160IPR003441NAC domain
PfamPF023651.6E-2612135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010224Biological Processresponse to UV-B
GO:0031930Biological Processmitochondria-nucleus signaling pathway
GO:1900409Biological Processpositive regulation of cellular response to oxidative stress
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MDLTVENGGL APGFRFHPTD EELVVYYLKR KIRRKKLRVD AIGETDVYKF DPEELPEKAL  60
YKTRDRQWFF FSLRDRKHGS RSSRATDRGY WKATGKDRVI KCDSRNVGEK KTLVFHRGRA  120
PNGERTNWVM HEYTLHEEEL KRCGGGDVKD AFVLYKIYKK SGSGPKNGEQ YGAPFIEEEW  180
AEDDDDVDEP AAVLDVPANQ LVVSAGVDNN LWGKGINQSE LDDNDIEELM RQVRDQPGRT  240
VQQNGVSGLN SHVETYNAVN LEDDMYLEID DLLLPEPEPE PASVEVMEKN WNQDGSGVLN  300
DNDFVDTDSY FLDLGATNPQ SDPVSVGLKN GFAQSLQVNT SLVIDQANNN LFQQNTGKNQ  360
ASNWPLRNSY TRQINNGSSW MPEINNDGLN ATPFGEAPGT GDASEFINPL TSGVSITKED  420
DASKDESSKF ASSVWTFLES IPANPAYASE NPFVKLNLVR MSSNGGRFRF ASKSTGNNVS  480
VTANDSAAKR KKYGGNNDKK KNNKGFFCLS IIGALCALFW VIIGTMGVSG RSLLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-441016620174NAC domain-containing protein 19
3swm_B6e-441016620174NAC domain-containing protein 19
3swm_C6e-441016620174NAC domain-containing protein 19
3swm_D6e-441016620174NAC domain-containing protein 19
3swp_A6e-441016620174NAC domain-containing protein 19
3swp_B6e-441016620174NAC domain-containing protein 19
3swp_C6e-441016620174NAC domain-containing protein 19
3swp_D6e-441016620174NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13037KIRRKKLR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Involved in oxidative stress tolerance by mediating regulation of mitochondrial retrograde signaling during mitochondrial dysfunction. Interacts directly with the mitochondrial dysfunction DNA consensus motif 5'-CTTGNNNNNCA[AC]G-3', a cis-regulatory elements of several mitochondrial retrograde regulation-induced genes, and triggers increased oxidative stress tolerance. {ECO:0000269|PubMed:24045019}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00176DAPTransfer from AT1G32870Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.14596s0002.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat, salt stress, abscisic acid (ABA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0349590.0AY034959.1 Arabidopsis thaliana putative NAM protein (At1g32870) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020866587.10.0NAC domain-containing protein 13
SwissprotF4IED20.0NAC13_ARATH; NAC domain-containing protein 13
TrEMBLD7KID50.0D7KID5_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.1__3425__AT1G32870.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153171517
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32870.10.0NAC domain protein 13
Publications ? help Back to Top
  1. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  2. O'Shea C, et al.
    Structures and Short Linear Motif of Disordered Transcription Factor Regions Provide Clues to the Interactome of the Cellular Hub Protein Radical-induced Cell Death1.
    J. Biol. Chem., 2017. 292(2): p. 512-527
    [PMID:27881680]