PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.14524s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 808aa    MW: 90388.6 Da    PI: 5.9849
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.14524s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.91.1e-29543594152
                RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Araha.14524s0004.1.p 543 AEKNITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 594
                           589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086533614IPR003035RWP-RK domain
PfamPF020422.2E-25546594IPR003035RWP-RK domain
SuperFamilySSF542778.1E-23698797No hitNo description
SMARTSM006663.7E-24709792IPR000270PB1 domain
PROSITE profilePS5174526.192709792IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-19710789No hitNo description
PfamPF005642.9E-17711790IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MENNSLPMDP AMDSSFMDGL LLEGCWLETT DASEFLNFSP STSVTPFDPS SFMCSPTQDT  60
SNSLSQMYGQ DSAERSSLED QGRDLSSLNR RWWIGPSGHG FSVMERLVQA VAHIKDFTSE  120
RGSLIQLWVP VDRGGKRVLT TKEQPFSHDP MCQRLAHYRE ISENYQFSTE QEDSGSSSRD  180
LVGLPGRVFL GKVPEWTPDV RFFKNEEYPR VQHAQDCDIR GTLAIPVFEQ GSQICLGVIE  240
VVMTTQMVKL SPDLESICRA LQAVDLRSTE IPIPPSLKGP DFSYQAALPE IRNLLRCACE  300
THKLPLAQTW VSCLKQSKTG CRHNDENYIH CVSTIDDACY VGDPTVREFH EACSEHHLLK  360
GQGVVGEAFL TNGPCFSSDV SSYKKSEYPL SHHATMFGLH GTVAIRLRCI HTGSADFVLE  420
FFLPKNCRDI EEQRKMLNAL STIMAHVPRS LRTVTEKELE EEGDSMVSEV IERGVTLPKI  480
ENTSEVHQSI SNPQNVGLVF DGGTTEMGEL GSDYCKGLSV NENNTFSSAS GFNRVTEKKR  540
TKAEKNITLD VLRQYFAGSL KDAAKNIGVC PTTLKRICRQ HGIQRWPSRK IKKVGHSLQK  600
IQRVIDSVEG VSGHHLPIGS FYASFPNLAS SPEASSLQQQ SKMTTFLPSS HSQHANSPGS  660
SCSHSSSCSS ETQVNKEDPT DKTRQVSISF KETQTTHLSP STSSQEDEYL RIKVSYEEEK  720
IRFRMRNSHR LKDLLWEIAK RFSIEDVSRY DLKYLDEDNE WVLLRCDDDV DECVDVCRSF  780
PGQTIKLLLQ LSSSYLPERS SVSGCPS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.14524s0004.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001321849.10.0Plant regulator RWP-RK family protein
RefseqNP_001321850.10.0Plant regulator RWP-RK family protein
RefseqNP_001321851.10.0Plant regulator RWP-RK family protein
RefseqNP_177761.10.0Plant regulator RWP-RK family protein
RefseqXP_020889931.10.0protein NLP5
RefseqXP_020889932.10.0protein NLP5
RefseqXP_020889933.10.0protein NLP5
RefseqXP_020889934.10.0protein NLP5
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLA0A178W0G00.0A0A178W0G0_ARATH; Uncharacterized protein
TrEMBLD7KTC40.0D7KTC4_ARALL; RWP-RK domain-containing protein
STRINGAT1G76350.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.2__1918__AT1G76350.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein