PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.14034s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 182aa    MW: 20869.4 Da    PI: 10.2984
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.14034s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.4e-4162137277
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           Cqv++C++d++eak yhrrhkvCevh+ka++v++sgl+qrfCqqCsrfhe++efDe+krsCrrrLa+hnerrrk++
  Araha.14034s0015.1.p  62 CQVDRCTSDMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHEIQEFDEAKRSCRRRLAGHNERRRKSS 137
                           **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375758.2E-611149IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.103.9E-3257123IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.57359136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-3761139IPR004333Transcription factor, SBP-box
PfamPF031102.1E-3162135IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MEGKRTQGQG YLKKKSYRVE EEMENDTDGE EVGREEEKRK GVMDRVRGSS GSIDRGGSLR  60
LCQVDRCTSD MKEAKLYHRR HKVCEVHAKA SSVFLSGLNQ RFCQQCSRFH EIQEFDEAKR  120
SCRRRLAGHN ERRRKSSGES TFGEGSGRRG ITGQVIQNQE RSRVEMTLPL PNSSFKRPQI  180
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-5148135184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0849020.0AY084902.1 Arabidopsis thaliana clone 12071 mRNA, complete sequence.
GenBankAJ0116320.0AJ011632.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 4, partial.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002891731.11e-115hypothetical protein ARALYDRAFT_474435
SwissprotQ9S7A91e-101SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLD7KKE31e-115D7KKE3_ARALL; Squamosa promoter-binding-like protein
STRINGfgenesh2_kg.1__4389__AT1G53160.21e-114(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-75squamosa promoter binding protein-like 4