PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.13692s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 379aa    MW: 42592.7 Da    PI: 4.6187
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.13692s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.91.5e-4761341129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           l+pGfrFhPtd elv +yLk+kv gkkl + ++i+evdiyk+eP dLp +  +++++ +w+fF++r+kkya+g r+nrat+ gyWk+tg
  Araha.13692s0015.1.p   6 LAPGFRFHPTDVELVRYYLKRKVLGKKLLV-DAIAEVDIYKFEPPDLPdMsFIRSGDLKWHFFCPREKKYASGVRANRATECGYWKTTG 93 
                           579************************999.89**************96346777888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           k+++vl+ ++e+vg  ktLv++ g++p+ge+tdWvmheyrle
  Araha.13692s0015.1.p  94 KERPVLC-NSEVVGKIKTLVYHFGKSPRGERTDWVMHEYRLE 134
                           *******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-573156IPR003441NAC domain
PROSITE profilePS5100552.3656156IPR003441NAC domain
PfamPF023655.2E-268133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGKTQLAPGF RFHPTDVELV RYYLKRKVLG KKLLVDAIAE VDIYKFEPPD LPDMSFIRSG  60
DLKWHFFCPR EKKYASGVRA NRATECGYWK TTGKERPVLC NSEVVGKIKT LVYHFGKSPR  120
GERTDWVMHE YRLEDKVLTQ MNVPQDTYVV CVLFKKDGPG PRNGAQYGAP FREEDWSDEE  180
QRTDLPSTKS CVSDFLPATS NTISELPHPS DAANTPMSTA PLAETLQTPN NDDLYSMLDL  240
FDDDEEFLGF NNNEVRHDPG VSAPVCLEEE GIFNGLPELS NMPRTASYDL IENSELYLEL  300
QDLTAPLNPH IGLQDLTAPL NPQTGMQDLT APLYPPTGNL NDPRSSSYLY NQGHFDFSAA  360
NDDDPYGFSA SMGRRPKM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-43615615168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.13692s0015.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3172170.0AK317217.1 Arabidopsis thaliana AT5G09330 mRNA, complete cds, clone: RAFL22-35-P15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020877302.10.0NAC domain-containing protein 82
SwissprotQ9FY820.0NAC82_ARATH; NAC domain-containing protein 82
TrEMBLD7M2270.0D7M227_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.6__879__AT5G09330.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.40.0NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]