PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.12281s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 159aa    MW: 18779.4 Da    PI: 8.7376
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.12281s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.79e-57101391129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++  ++   e++ewyfFs++dkky+tg+r+nrat +g+Wkat
  Araha.12281s0001.1.p  10 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcRIGYeERNEWYFFSHKDKKYPTGTRTNRATMAGFWKAT 97 
                           69****************************.9***************953433332556****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           g+dk+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Araha.12281s0001.1.p  98 GRDKAVYD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 139
                           ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-587144IPR003441NAC domain
PROSITE profilePS5100555.76810158IPR003441NAC domain
PfamPF023656.6E-3011138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MESVDQSCSV PPGFRFHPTD EELVGYYLRK KVASQKIDLD VIRDIDLYRI EPWDLQERCR  60
IGYEERNEWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KAVYDKSKLI GMRKTLVFYK  120
GRAPNGQKTD WIMHEYRLES DENAPPQVFS FYCDIILK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-5141389140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.12281s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0221411e-160AL022141.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F23E13 (ESSAII project).
GenBankAL1615881e-160AL161588.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 84.
GenBankCP0026871e-160CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010437369.11e-107PREDICTED: NAC domain-containing protein 76
RefseqXP_020875750.11e-107NAC domain-containing protein 76
SwissprotO655081e-107NAC76_ARATH; NAC domain-containing protein 76
TrEMBLD7MBP01e-106D7MBP0_ARALL; Uncharacterized protein
STRINGCagra.4734s0006.1.p1e-107(Capsella grandiflora)
STRINGfgenesh2_kg.7__450__AT4G36160.11e-107(Arabidopsis lyrata)
STRINGXP_010432195.11e-107(Camelina sativa)
STRINGXP_010437369.11e-107(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69502744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.11e-110NAC domain containing protein 76
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]