PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1212s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 462aa    MW: 51773.7 Da    PI: 5.617
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1212s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.27.9e-50131411128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          lp+GfrF+Ptdeelv +yL+ k++g++ ++ +vi+e+di+k+ePwdLp  + vk+ + ew fF++ d+ky++g+r nrat +gyWkatgk
  Araha.1212s0002.1.p  13 LPVGFRFSPTDEELVRYYLRLKINGHDDDV-RVIREIDICKWEPWDLPdfSVVKTIDAEWLFFCPLDRKYPSGSRMNRATVAGYWKATGK 101
                          79*************************999.99***************6447777889******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d++++s k++ +g+k+tLvfy+grapkg++t W+mheyr+
  Araha.1212s0002.1.p 102 DRKIKSGKTKIIGVKRTLVFYTGRAPKGTRTCWIMHEYRA 141
                          ******9999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-565164IPR003441NAC domain
PROSITE profilePS5100554.14713164IPR003441NAC domain
PfamPF023657.7E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MKEDMEVLSL ASLPVGFRFS PTDEELVRYY LRLKINGHDD DVRVIREIDI CKWEPWDLPD  60
FSVVKTIDAE WLFFCPLDRK YPSGSRMNRA TVAGYWKATG KDRKIKSGKT KIIGVKRTLV  120
FYTGRAPKGT RTCWIMHEYR ATEKDLDGTK SGQNPFVVCK LFKKQDIVNG AAAEESKSCE  180
VEPAVSSPTL VDEMKSEVEM SEVSPVLEDT KPCGVAESSL VVSSECRSEN SAPEVTTTGL  240
DDIDWLSFME FDSVNQNLFS PLPSQVQSEL CSSFNGFQSG TSQLFNEDHI QTQYGTNDAD  300
EYMSKFLDSL LEIPYELPGR KEFVQQTPEH ITYEPQNLST CNRINDVTET GIKIRARRAQ  360
APGCAEQFVM QGDASRRLRL QVNLNTHKSE TDSTQLQCIK KEVKDTTTET IAKGCGNFTR  420
SKSRTSFIFK KIAAMGCSYR GFFRAGVVAA VFVMSVCSLV A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-4731657166NO APICAL MERISTEM PROTEIN
1ut4_B8e-4731657166NO APICAL MERISTEM PROTEIN
1ut7_A8e-4731657166NO APICAL MERISTEM PROTEIN
1ut7_B8e-4731657166NO APICAL MERISTEM PROTEIN
3swm_A1e-46316510169NAC domain-containing protein 19
3swm_B1e-46316510169NAC domain-containing protein 19
3swm_C1e-46316510169NAC domain-containing protein 19
3swm_D1e-46316510169NAC domain-containing protein 19
3swp_A1e-46316510169NAC domain-containing protein 19
3swp_B1e-46316510169NAC domain-containing protein 19
3swp_C1e-46316510169NAC domain-containing protein 19
3swp_D1e-46316510169NAC domain-containing protein 19
4dul_A8e-4731657166NAC domain-containing protein 19
4dul_B8e-4731657166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.1212s0002.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2810620.0AF281062.1 Arabidopsis thaliana TIP mRNA, complete cds.
GenBankBT0020120.0BT002012.1 Arabidopsis thaliana NAC2-like protein (At5g24590) mRNA, complete cds.
GenBankBT0096830.0BT009683.1 Arabidopsis thaliana At5g24590 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002874210.10.0NAC domain-containing protein 91
SwissprotQ9LKG80.0NAC91_ARATH; NAC domain-containing protein 91
TrEMBLD7M3670.0D7M367_ARALL; Tip
STRINGfgenesh1_pm.C_scaffold_60019680.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.20.0TCV-interacting protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  3. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]