PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.11900s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 350aa    MW: 39027.5 Da    PI: 4.6049
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.11900s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573132.12.1e-41134229297
                DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkife 90 
                           +fqrlwse+Dei++LqGlid+k++tg+sp++d +++y++vkks+sf+vsk q++eK+r LKk+++++  kak+g+ep+f k+hd+k+fe
  Araha.11900s0012.1.p 134 YFQRLWSEDDEIAVLQGLIDYKNDTGVSPFEDKNKVYQMVKKSVSFDVSKIQFMEKLRTLKKRYENNLGKAKDGDEPTFVKPHDRKAFE 222
                           79*************************************************************************************** PP

                DUF573  91 lskkiWg 97 
                           lsk +Wg
  Araha.11900s0012.1.p 223 LSKLVWG 229
                           ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.7E-33135229IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MSRKRFNPLE DPPAASSSDE DDLETSMGEG EEDVARNSSS EEEDDVSSKT PAALKNTVLL  60
LAAPTEKLVS DPESGSDEET DTDSEPEMKD QVVTKRSRET DEAAASTDVK RAKKVSVEED  120
KKSGGGGEET KKTYFQRLWS EDDEIAVLQG LIDYKNDTGV SPFEDKNKVY QMVKKSVSFD  180
VSKIQFMEKL RTLKKRYENN LGKAKDGDEP TFVKPHDRKA FELSKLVWGG IRMVLQSGMK  240
SNGKSKKVES VKHEIDCEDD VTNKGEASLL GALEMDTLVK SSLVRSIARF GLDELVAQEG  300
FSLLSSEDKK RFEEQWKALQ VMEFEFLSQK CGFLHEVVTK MTEVSRSNT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0116611e-134AC011661.5 Genomic sequence for Arabidopsis thaliana BAC T23J18 from chromosome I, complete sequence.
GenBankCP0026841e-134CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAB4934491e-134AB493449.1 Arabidopsis thaliana At1g11510 gene for hypothetical protein, partial cds, clone: RAAt1g11510.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492929.11e-137PREDICTED: mediator-associated protein 1-like
TrEMBLC0SUU61e-129C0SUU6_ARATH; DNA-binding storekeeper protein-related transcriptional regulator (Fragment)
STRINGAT1G11510.11e-128(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.12e-98DNA-binding storekeeper protein-related transcriptional regulator