PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.11372s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 397aa    MW: 44152.1 Da    PI: 8.0308
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.11372s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.91.9e-40175251177
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           +Cq++gCe dls+ak+yhr+h+vCe+hsk+p+v+vsgle+rfCqqCsrfh++sefDe+krsCr+rL++hn+rrrk+q
  Araha.11372s0006.1.p 175 RCQIDGCELDLSSAKDYHRKHRVCEKHSKCPKVIVSGLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQ 251
                           6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-33168237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.556173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37174251IPR004333Transcription factor, SBP-box
PfamPF031107.7E-31176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MDCNMVSSFQ WDWENLIMSN PSKTENEKRQ QSTEWEFEKG DGIESIVPDF LGFEKVGSVS  60
ATSFWHTAVS KSSQSTSINS SSPEVNRCNL ASQRSPGDSS SNIDFVQVKA STALEVSVAS  120
AESDLCLKLG KRTYSEEFWG SNNNDISAVS MNLLTPSVVA RKKTKSCGQS MQVPRCQIDG  180
CELDLSSAKD YHRKHRVCEK HSKCPKVIVS GLERRFCQQC SRFHAVSEFD EKKRSCRKRL  240
SHHNARRRKP QGVFPLNSER VYDRRQHTNM LWNGLSLNTR SEEKYAWGTT YETKPTQMES  300
GFTLSFQRGN GSEEQLFASS SLSFSAFQTS GGFPAGKSNV QLPDKGVGEC SGGLHESHDF  360
YSALSLLSTT SDSQGIKHNP VAEPPPIFGT FPTHFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-261762491184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231248KKRSCRKRLSHHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.11372s0006.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116370.0AJ011637.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 10.
GenBankAY1420280.0AY142028.1 Arabidopsis thaliana At1g27370/F17L21_16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020867903.10.0squamosa promoter-binding-like protein 10
RefseqXP_020867904.10.0squamosa promoter-binding-like protein 10
RefseqXP_020867905.10.0squamosa promoter-binding-like protein 10
RefseqXP_020867906.10.0squamosa promoter-binding-like protein 10
RefseqXP_020867907.10.0squamosa promoter-binding-like protein 10
RefseqXP_020867908.10.0squamosa promoter-binding-like protein 10
RefseqXP_020867909.10.0squamosa promoter-binding-like protein 10
SwissprotQ8S9L00.0SPL10_ARATH; Squamosa promoter-binding-like protein 10
TrEMBLD7KBP40.0D7KBP4_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.1__2893__AT1G27370.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50041653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.40.0squamosa promoter binding protein-like 10
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Yu N,Niu QW,Ng KH,Chua NH
    The role of miR156/SPLs modules in Arabidopsis lateral root development.
    Plant J., 2015. 83(4): p. 673-85
    [PMID:26096676]
  3. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]
  4. Gao R,Wang Y,Gruber MY,Hannoufa A
    miR156/SPL10 Modulates Lateral Root Development, Branching and Leaf Morphology in Arabidopsis by Silencing AGAMOUS-LIKE 79.
    Front Plant Sci, 2017. 8: p. 2226
    [PMID:29354153]
  5. Dotto M,Gómez MS,Soto MS,Casati P
    UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana.
    Plant Cell Environ., 2018. 41(6): p. 1394-1406
    [PMID:29447428]