PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.11372s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 393aa    MW: 44004.1 Da    PI: 8.4368
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.11372s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP124.25.7e-39174250177
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           +Cq+++Ce dls+ak yhr+h+vCe+hsk+p+v vsgl +rfCqqCsrfh++sefD++krsCr+rL++hn+rrrk+q
  Araha.11372s0005.1.p 174 RCQIDNCELDLSSAKGYHRKHRVCEKHSKCPKVSVSGLVRRFCQQCSRFHDVSEFDDKKRSCRKRLSHHNARRRKPQ 250
                           6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-30168236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.317172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-36173251IPR004333Transcription factor, SBP-box
PfamPF031103.4E-29175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MDCSMVSSFQ WDWESLIMSN PSKTENEKRQ QSTEWEIEKG DGIESIVPHF SGLERFSSGS  60
ATSFWHTAVS KSSQSTSIHS SSPEVKRCKL ASESSPGDSC SNVNFVQVKT STAPEVSVAS  120
AESDLCLKLG KRTYSEEYWG RNNNEISAVS MKLLTPSVVT RKNSKCGQSM LVPRCQIDNC  180
ELDLSSAKGY HRKHRVCEKH SKCPKVSVSG LVRRFCQQCS RFHDVSEFDD KKRSCRKRLS  240
HHNARRRKPQ GVFSVNPERL YDRRQHTNML WNELSLNTRS EELCEWGTTY DTKPTQTEKG  300
FTLSFQRGNG SEDQLVASNS RMFSTVQTSG GFPAGKSKFQ LHGEAVGEYS GVLHESQDFH  360
RALSLLSTSS DPLAQPHAQP FSPLCSYDVV PK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-271752481184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1230247KKRSCRKRLSHHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00161DAPTransfer from AT1G27360Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.11372s0005.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116350.0AJ011635.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 11.
GenBankAY0701060.0AY070106.1 Arabidopsis thaliana putative squamosa-promoter binding protein 2 (At1g27360) mRNA, complete cds.
GenBankAY0881850.0AY088185.1 Arabidopsis thaliana clone 42666 mRNA, complete sequence.
GenBankAY0912860.0AY091286.1 Arabidopsis thaliana putative squamosa-promoter binding protein 2 (At1g27360) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890724.10.0squamosa promoter-binding-like protein 11
RefseqXP_020867910.10.0squamosa promoter-binding-like protein 11
RefseqXP_020867912.10.0squamosa promoter-binding-like protein 11
RefseqXP_020867913.10.0squamosa promoter-binding-like protein 11
SwissprotQ9FZK00.0SPL11_ARATH; Squamosa promoter-binding-like protein 11
TrEMBLD7KBP30.0D7KBP3_ARALL; Uncharacterized protein
STRINGscaffold_103051.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50041653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.40.0squamosa promoter-like 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Stief A, et al.
    Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors.
    Plant Cell, 2014. 26(4): p. 1792-1807
    [PMID:24769482]
  3. Liu J, et al.
    The RhoGAP SPIN6 associates with SPL11 and OsRac1 and negatively regulates programmed cell death and innate immunity in rice.
    PLoS Pathog., 2015. 11(2): p. e1004629
    [PMID:25658451]
  4. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]