PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.11267s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YC
Protein Properties Length: 208aa    MW: 22875.9 Da    PI: 10.3269
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.11267s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC48.32.2e-151021891299
                 NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                            ++d k  ++P+ ri++i++ d+   +i  +a  l+ ka e+fi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  Araha.11267s0002.1.p 102 GVEDAKMFKFPMNRIRRIMRIDNSAPQIMQDAVFLVNKATEMFIKRFSEEAYDSSVQDKKKFIHYKHLSSVVSNDVRYEFLADSVPEK 189
                           57899999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.51E-18109188IPR009072Histone-fold
PfamPF008081.1E-20110173IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.1E-22111188IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MVSSKKPKDK KARSDAVVNK AGGRNTRSSG SKAKKATIKV NIVKKVPEIH EISESSSSDS  60
VEEAIRGDGA KKSNGVVSKG RNGKSGGVST KTSKNREEDD GGVEDAKMFK FPMNRIRRIM  120
RIDNSAPQIM QDAVFLVNKA TEMFIKRFSE EAYDSSVQDK KKFIHYKHLS SVVSNDVRYE  180
FLADSVPEKL KAEAALEEWE RGMTDAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252660.0BT025266.1 Arabidopsis thaliana At1g07980 mRNA, complete cds.
GenBankAY0868150.0AY086815.1 Arabidopsis thaliana clone 28026 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892427.11e-122hypothetical protein ARALYDRAFT_334085
TrEMBLD7KHX61e-122D7KHX6_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10006501e-121(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.19e-90nuclear factor Y, subunit C10