PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1084s0026.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 290aa    MW: 33780 Da    PI: 6.7921
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1084s0026.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.1e-54121382127
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          ppGfrFhPtdeelv +yLkkkv++++++l +vi+++d+yk+ePwdL++     ++e+kewyfFs++dkky+tg+r+nrat +g+Wkatg+
  Araha.1084s0026.1.p  12 PPGFRFHPTDEELVGYYLKKKVASQRIDL-DVIRDIDLYKIEPWDLQErcrIGYEEQKEWYFFSHKDKKYPTGTRTNRATVAGFWKATGR 100
                          9****************************.9***************953432234677******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                          dk+v+  +++l+g++ktLvfy+grap+g+k+dW++hey 
  Araha.1084s0026.1.p 101 DKAVYL-NSKLIGMRKTLVFYRGRAPNGQKSDWIIHEYY 138
                          ******.999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-596161IPR003441NAC domain
PROSITE profilePS5100557.17211161IPR003441NAC domain
PfamPF023651.2E-2612137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MMKVDQESCS IPPGFRFHPT DEELVGYYLK KKVASQRIDL DVIRDIDLYK IEPWDLQERC  60
RIGYEEQKEW YFFSHKDKKY PTGTRTNRAT VAGFWKATGR DKAVYLNSKL IGMRKTLVFY  120
RGRAPNGQKS DWIIHEYYSL ESHQNSPPLE EGWVVCRAFK KRTNVPTKRR QLWDSNCFFY  180
DASTLLEPLD KRARHNPEFG GTPFKQELLS EANHVEDGDF GSMYLQSMDD DQFYQLPQLE  240
SPSLPSEITP QISENSSRKD NVSAEKRITD WRSLDKFVAS QLLMSSGED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-49616310170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00590DAPTransfer from AT5G66300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.1084s0026.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0158240.0BT015824.1 Arabidopsis thaliana At5g66300 gene, complete cds.
GenBankBT0202160.0BT020216.1 Arabidopsis thaliana At5g66300 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865078.20.0NAC domain-containing protein 105 isoform X2
SwissprotQ9FH590.0NC105_ARATH; NAC domain-containing protein 105
TrEMBLD7MMZ10.0D7MMZ1_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.8__2792__AT5G66300.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151341619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66300.10.0NAC domain containing protein 105
Publications ? help Back to Top
  1. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]