PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.10517s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 818aa    MW: 91515.7 Da    PI: 5.396
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.10517s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1352.4e-42121197278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           Cqve+C adls++k+yhrrhkvCe+hska+++lv g++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Araha.10517s0003.1.p 121 CQVENCGADLSKVKDYHRRHKVCEMHSKATSALVGGIMQRFCQQCSRFHVLEEFDEGKRSCRRRLAGHNKRRRKANP 197
                           **************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-34116182IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.565118195IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-39120199IPR004333Transcription factor, SBP-box
PfamPF031103.6E-31121194IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.201.7E-6706810IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484039.24E-7708809IPR020683Ankyrin repeat-containing domain
CDDcd002045.11E-8711809No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MEARIEGEVE GHSLGYGFSG KRSVEWDLND WKWNGDLFVA TQLNHGSSNS SSTCSDEANV  60
EIMEKKKKRG AITVIAVEED NLRDGDDDAH RLTLNLGGNI EGNGAKKTKL GGGIPSRAIS  120
CQVENCGADL SKVKDYHRRH KVCEMHSKAT SALVGGIMQR FCQQCSRFHV LEEFDEGKRS  180
CRRRLAGHNK RRRKANPDIG NGNPLSDDQT SNYMLITLLK ILSNIHTNQS DQTGDQDLLS  240
HLLKSLVSQA GEHIGRNLVG LLQGGVGLQA SQNIGNSSAL LSLEQAPRED IKHHSVPETN  300
WQEVYANGAQ ETAAPDRSEK QVKMNDFDLN DIYIDSDDTT DIERSSPPPT NPATSSLDYH  360
QDSRQSSPPQ TSRRNSDSAS DQSPSSSSGD GQSRTDRIVF KLFGKEPNDF PVALRGQILN  420
WLAHTPTDME SYIRPGCIVL TIYLRQDEAS WEELCCDLSF SLRRLLDLSD DPLWTDGWIY  480
LRVQNQLAFA FDGQVVLDTS LPLRSHDYSQ IIAVRPLAVT RKAQFTVKGI NLRRPGTRLL  540
CAVEGTYLVQ EATQGVMEER DELKENNEID FVKFSCEMPI ASGRGFMEIE DQGGLSSSYF  600
PFIVSEDEDV CSEIRRLEST LEFTGTDSAM QAMDFIHEIG WLLHRSELKS RLAASDHNPE  660
DLFPLIRFKF LIEFSMDREW YAVIKKLLNI LFEEGTVDPS PDAALSELCL LHRAVRKNSK  720
PMVEMLLRFI PKKMNQTLSG LFRPDAAGPG GLTPLHIAAG KDGSEDVLDA LTEDPDMIGI  780
QAWKISRDNT GFTPEDYARL RGHFSYIHLV QRKLNRKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A4e-34118175360squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00060PBMTransfer from AT3G60030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.10517s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936580.0AB493658.1 Arabidopsis thaliana At3g60030 mRNA for hypothetical protein, partial cds, clone: RAAt3g60030.
GenBankAJ1320960.0AJ132096.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002878311.10.0squamosa promoter-binding-like protein 12
RefseqXP_020880464.10.0squamosa promoter-binding-like protein 12
RefseqXP_020880465.10.0squamosa promoter-binding-like protein 12
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLD7LWK10.0D7LWK1_ARALL; Uncharacterized protein
STRINGscaffold_503227.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Jung S, et al.
    Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes.
    BMC Genomics, 2006. 7: p. 81
    [PMID:16615871]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]