PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.10341s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 331aa    MW: 37621.9 Da    PI: 5.0123
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.10341s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.65.3e-49111352127
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                            pGf+F+Ptd el+++yLk+k++g + ++ e+i+evdiy++ePwdLp k++ ++++ew+fF+ r kky++g++++rat+ gyWkatgk+
  Araha.10341s0001.1.p  11 FPGFKFSPTDIELISYYLKRKMDGLEKSV-EIIPEVDIYNFEPWDLPdKSIVKSDSEWFFFCARGKKYPHGSQNRRATRMGYWKATGKE 98 
                           59************************999.99***************778888899********************************* PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                           ++v+s ++e++g+k+tLvf+ grapkge+t+W+mhey 
  Araha.10341s0001.1.p  99 RNVKS-SSEVIGTKRTLVFHIGRAPKGERTEWIMHEYG 135
                           *****.999****************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-528151IPR003441NAC domain
PROSITE profilePS5100551.44710152IPR003441NAC domain
PfamPF023651.2E-2412135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAAEPAVTTA FPGFKFSPTD IELISYYLKR KMDGLEKSVE IIPEVDIYNF EPWDLPDKSI  60
VKSDSEWFFF CARGKKYPHG SQNRRATRMG YWKATGKERN VKSSSEVIGT KRTLVFHIGR  120
APKGERTEWI MHEYGMIGVS LDALVICRLR RNTEFQGATI QNPPQPSLPS DKHENLQNEA  180
ILESISGWEN MVDFYLSSES GQELLSEIAE SSQSSQNPQV PSEEYFYADI LRDEIVKLDD  240
PAVSGNTLTN VPKLQTESYT TRVLPLPDMV DKQMQSLLQK LPLQNDTGEE NNISMSNCFI  300
GIYSIKSINR ARWGVVVWLL VMIAVLVFYL V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-421215222168NAC domain-containing protein 19
3swm_B1e-421215222168NAC domain-containing protein 19
3swm_C1e-421215222168NAC domain-containing protein 19
3swm_D1e-421215222168NAC domain-containing protein 19
3swp_A1e-421215222168NAC domain-containing protein 19
3swp_B1e-421215222168NAC domain-containing protein 19
3swp_C1e-421215222168NAC domain-containing protein 19
3swp_D1e-421215222168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcription factor involved in modulation of abscisic acid (ABA) signaling. Attenuates ABA sensitivity and glucose-induced ABA accumulation. Reduces the expression of ABI4 gene. {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:24625790}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.10341s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By glucose (PubMed:24625790). Induced by salt, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:24625790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002877331.10.0NAC domain-containing protein 60 isoform X1
SwissprotQ9LXL90.0NAC60_ARATH; NAC domain-containing protein 60
TrEMBLD7LNQ50.0D7LNQ5_ARALL; ANAC060
STRINGfgenesh1_pg.C_scaffold_50009020.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43092356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.10.0NAC domain containing protein 60
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]