PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.10219s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 514aa    MW: 56520.1 Da    PI: 7.8907
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.10219s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.4e-33178235260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh+k
  Araha.10219s0008.1.p 178 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-EGQITEIVYKGSHNHPK 235
                           7****************************************.***************85 PP

2WRKY1053.9e-33355413159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  Araha.10219s0008.1.p 355 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDMRAVITTYEGKHNHD 413
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-28169236IPR003657WRKY domain
SMARTSM007742.3E-34177235IPR003657WRKY domain
SuperFamilySSF1182901.44E-24177236IPR003657WRKY domain
PfamPF031063.8E-25178234IPR003657WRKY domain
PROSITE profilePS5081122.905178236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.3E-37340415IPR003657WRKY domain
SuperFamilySSF1182903.14E-29347415IPR003657WRKY domain
PROSITE profilePS5081138.434350415IPR003657WRKY domain
SMARTSM007741.8E-38355414IPR003657WRKY domain
PfamPF031062.0E-25356413IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MAASSFLTMD NSRTRQNMNG SANNWSQRTS TSSLEDLEIP KFRSFAPSSI SISPSLASPS  60
TCFSPSVFLD SPAFVSSSAN VLASPTTGAL ITNGSNQKVI NEGEKSNNNI NFFDFSFHTQ  120
SSGVSAPITT TTTTTTNSSI FQPQEQQRKN QSEQWNQTET RPNNQAVSYN GREQRKGEDG  180
YNWRKYGQKQ VKGSENPRSY YKCTFPNCPT KKKVERSLEG QITEIVYKGS HNHPKPQSTR  240
RSSSSSSTFH SAVYNASLDH NRQASSDQPN SNNSFHQSDS FGMQQEDNTT SDSVGDDEFE  300
QGSSVVSREE EDCGSEPEAK RWKGDNETNG GNGGGSKTVR EPRIVVQTTS DIDILDDGYR  360
WRKYGQKVVK GNPNPRSYYK CTTIGCPVRK HVERASHDMR AVITTYEGKH NHDVPAARGS  420
GYATNRAPQD ASSVPIRPAA IAGHSNYTAS SQAPYTLQML HNNNTNSGAF GYAMNNNNNN  480
SNLQTQQNFV GGGFSRAKEE PNEETSFFDS FLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-38178416878Probable WRKY transcription factor 4
2lex_A9e-38178416878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0330300.0BT033030.1 Arabidopsis thaliana unknown protein (At2g38470) mRNA, complete cds.
GenBankAK2263010.0AK226301.1 Arabidopsis thaliana mRNA for putative WRKY-type DNA binding protein, complete cds, clone: RAFL05-11-J06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293466.10.0hypothetical protein CARUB_v10023006mg
SwissprotQ8S8P50.0WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLR0HAD40.0R0HAD4_9BRAS; Uncharacterized protein
STRINGAT2G38470.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.10.0WRKY DNA-binding protein 33