PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1020s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 689aa    MW: 75739.2 Da    PI: 6.1491
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1020s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.64e-16392430240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Araha.1020s0004.1.p 392 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 430
                          689**********************************96 PP

2TCR51.71.7e-16477515139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+C+N 
  Araha.1020s0004.1.p 477 RHKRGCNCKKSNCLKKYCECYQGGVGCSMNCRCEGCQNV 515
                          589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19391432IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.436392517IPR005172CRC domain
PfamPF036386.6E-12394429IPR005172CRC domain
SMARTSM011143.2E-17477518IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11479514IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
NPTSQIGTST PKSKFEDSPV FNYISNLSPI ESVKSISTAQ TFSSLSFTSP PPVFTSPHVN  60
SHRESRFFRC HNSVDHAKHL ESLDGSAVKE EVVVPVIEDL NKEASLEDEE ETSVETAYEL  120
PQILKFSSQT PEDSDSPCTE DIVIEASSDP PRGDGGSSSE DVKMGVENML VVREEKDTPD  180
CGRLISDATE LLVFRSPNDS EAFRCLVDKI SSSERRFCAG VKSTKRPKIT EDVPANGSSN  240
ENEPLTVLPN ESVFNLHRGG MRRRCLDFEM PGKRKKDIAD DHQSVCDNNV AGESSSRCVV  300
PGIGLHLNAV AMSAKDININ LIHDYSISGE IQKSFSGSTI PIHSQDTVQE TSDQAENEPV  360
EEIPKALEFP SLNLGSLKKK MRKSEQAGEG ESCKRCNCKK SKCLKLYCEC FAAGVYCIEP  420
CSCIDCFNKP IHEETVLATR KQIESRNPLA FAPKVIRSAD SVMEAGDDAS KTPASARHKR  480
GCNCKKSNCL KKYCECYQGG VGCSMNCRCE GCQNVFGRKE GSLLVIMESK LEEDQETYEK  540
RIAKIQHNIE VSKEVEQNPS SDQPSTPLPP YRHLVVHQPF LSKNRLPPTQ FFLGTGSSSF  600
RKPDSGLTQS QNEKKPLETV AEDKTEIMPE ILLNSPIANI KAISPNSKRV SPPQPGSSES  660
GSILRRRGNG RKLILRSIPA FPSLNPNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1639651514121Protein lin-54 homolog
5fd3_B3e-1639651514121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261275RRRCLDFEMPGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.1020s0004.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040590.0AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063240.0AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020886693.10.0CRC domain-containing protein TSO1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLD7L2F30.0D7L2F3_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.3__2490__AT3G22780.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]