PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.10017s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 348aa    MW: 38799.4 Da    PI: 9.4446
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.10017s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.26.2e-4058135178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +CqvegC++dls++k y++rhkvC +hsk+++v+vsgl+qrfCqqCsrfh+lsefD ekrsCrrrLa hnerrrk+q+
  Araha.10017s0002.1.p  58 RCQVEGCRTDLSNVKAYYSRHKVCCIHSKSSKVIVSGLHQRFCQQCSRFHQLSEFDLEKRSCRRRLACHNERRRKPQP 135
                           6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3051120IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.97556133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-3757137IPR004333Transcription factor, SBP-box
PfamPF031101.3E-2859132IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0042127Biological Processregulation of cell proliferation
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MELLMGSGQA ESGGSSSTES SSLSGGLRFG QKIYFEDGSG SGSKNRVNTG RKSTMTARCQ  60
VEGCRTDLSN VKAYYSRHKV CCIHSKSSKV IVSGLHQRFC QQCSRFHQLS EFDLEKRSCR  120
RRLACHNERR RKPQPTTSLF TSRYSRIAPS LYGNPNAAMI KSVLGDPMAW STAKSVMRRS  180
GPWQINPERE SRHQLLNVLS HGSSSFTTCP EIINNNSTDS SCALSLLSNS NPIQQQQLQT  240
PTNLWRPSSG FDSMISFSNR VTMAQPPPIS THHQYLSQTW EVMAGEKSNS HYMSPVSQIS  300
EPADFQISNG TTMGGFELSL HQQVLRQYME PENTRAYDSS QHFNWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28591321184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00412DAPTransfer from AT3G57920Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.10017s0002.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0863840.0AY086384.1 Arabidopsis thaliana clone 247919 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002878178.10.0squamosa promoter-binding-like protein 15
SwissprotQ9M2Q60.0SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBLD7LVY00.0D7LVY0_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.5__2235__AT3G57920.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.10.0squamosa promoter binding protein-like 15
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Morea EG, et al.
    Functional and evolutionary analyses of the miR156 and miR529 families in land plants.
    BMC Plant Biol., 2016. 16: p. 40
    [PMID:26841873]
  3. Hyun Y, et al.
    Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem.
    Dev. Cell, 2016. 37(3): p. 254-66
    [PMID:27134142]
  4. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]