PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.0305s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 520aa    MW: 55610.2 Da    PI: 8.0727
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.0305s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461.1e-144382141
                  TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                         ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Araha.0305s0002.1.p 43 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 82
                         589**************************.********986 PP

2TCR50.93.1e-16128167140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Araha.0305s0002.1.p 128 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 167
                          589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-164383IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.42744168IPR005172CRC domain
PfamPF036386.3E-114580IPR005172CRC domain
SMARTSM011141.5E-19128169IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-12131166IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MATTSNPPSQ SQILNAPIRH PKPESPKARG PRPIVEGRDG TPQKKKQCNC KHSRCLKLYC  60
ECFASGTYCD GCNCVNCFNN VDNEPARREA VEATLERNPF AFRPKIASSP HGVRDKREDI  120
GEVVLLGKHN KGCHCKKSGC LKKYCECFQA NILCSENCKC LDCKNFEGSE ERQALFHGEH  180
ANHMAYLQQA ANAAITGAVG SSGFAPSPAP KRRKGQEILF NQATKDSSRL GQFPQVNSGR  240
ASGPTSGSSP SPVSRAGGNA SSAPSKFVYR SLLADIIQPH DVRALCSVLV AVAGEAAKTS  300
TDKRNEIENR VEDQTETSLA SSAQDQPQGN NDAADMEMVA TDGNQADKSG PEESNSDGAD  360
ASKGNPLSPA TLALMCDEQD TIFMVAAPSP NGAVDPGGRR TNSQGQSEIY AEQERLVLTK  420
FRDCLSRLIS YAEIKESKCL SLARMHIQPP ATATVKTENG VQQQVPIVNG ASRTNSQPTL  480
NKPQPMQLIN TTSASAAAAA ATNTHHLHKP PALSEKKDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-314517711132Protein lin-54 homolog
5fd3_B1e-314517711132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.0305s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020874783.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLD7MD610.0D7MD61_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.7__1291__AT4G29000.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein