PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.0091s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 365aa    MW: 40612.8 Da    PI: 4.9246
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.0091s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573129.21.7e-40152247297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqr+w+e+Dei++LqGlidf+++tg+sp+dd++++ye +k sisf+vsk q++eK+r+L+kK++++  kaksg+ep+f ++hd+k+fel
  Araha.0091s0008.1.p 152 YFQRVWTEDDEIAVLQGLIDFRNDTGVSPYDDTNRVYELLKISISFDVSKVQFMEKLRNLRKKYENNLVKAKSGDEPTFVRTHDRKAFEL 241
                          79**************************************************************************************** PP

               DUF573  92 skkiWg 97 
                          sk +Wg
  Araha.0091s0008.1.p 242 SKFVWG 247
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.0E-32153247IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSHKRFNTPT ASSSDEDEAE TPIREVEDSS SDEEDDVVSS KNPSSAVMKK QVSDSESGSD  60
SDEETDSDSE EPLKKDEVVT NPVKLVTEAK DSVLKKNQES KKVKDSEKSV AKCSRETDEA  120
AGSGSTDVKR VKKVSGEEEK KSGGGEETKK AYFQRVWTED DEIAVLQGLI DFRNDTGVSP  180
YDDTNRVYEL LKISISFDVS KVQFMEKLRN LRKKYENNLV KAKSGDEPTF VRTHDRKAFE  240
LSKFVWGAIE SAVKSSGKSK KSSKSKKVES VNHELDSSLP NGKNEAAADL DTFPKSSLVR  300
SLVRFGFDEF SAQQGLSSLA LEDKKRFEEQ WKALQVREFE FYSQKSGFLH EVVAKMAEAF  360
PSNA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492929.11e-131PREDICTED: mediator-associated protein 1-like
TrEMBLC0SUU61e-120C0SUU6_ARATH; DNA-binding storekeeper protein-related transcriptional regulator (Fragment)
STRINGAT1G11510.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.15e-87DNA-binding storekeeper protein-related transcriptional regulator