PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.0070s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 333aa    MW: 37951 Da    PI: 8.9924
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.0070s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.21.3e-56171421128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeel+++yL+kkv +  +++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdk
  Araha.0070s0003.1.p  17 LPPGFRFHPTDEELITHYLHKKVLDIGFSA-KAIGEVDLNKAEPWELPYKAKMGEKEWYFFCVRDRKYPTGLRTNRATQAGYWKATGKDK 105
                          79**************************99.88***************99999************************************* PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          e+++ +++lvg+kktLvfy+grapkg+kt+Wvmheyrl
  Araha.0070s0003.1.p 106 EIFR-GKSLVGMKKTLVFYRGRAPKGQKTNWVMHEYRL 142
                          ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-6513167IPR003441NAC domain
PROSITE profilePS5100560.05317167IPR003441NAC domain
PfamPF023657.2E-3018142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
METFGVFHKE DDEQMDLPPG FRFHPTDEEL ITHYLHKKVL DIGFSAKAIG EVDLNKAEPW  60
ELPYKAKMGE KEWYFFCVRD RKYPTGLRTN RATQAGYWKA TGKDKEIFRG KSLVGMKKTL  120
VFYRGRAPKG QKTNWVMHEY RLDGKLSAHN LPKTAKNEWV ICRVFHKTAG GKKIPISTLI  180
RIGSYGTGSS LPPLIDSSPY NDKTKTEPVY VPCFSNQAET RGTILNCFSN PSLSSVQPDF  240
LQMIPLYQPQ SLNISENLQS SNPVLTQEQS VLQAMMENNR RQNFKTLSIS QETEVSNTDN  300
SSVFEFGRKR FDHQEVPSSS SGPVDLEPFW NY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-5641737174NAC domain-containing protein 19
3swm_B4e-5641737174NAC domain-containing protein 19
3swm_C4e-5641737174NAC domain-containing protein 19
3swm_D4e-5641737174NAC domain-containing protein 19
3swp_A4e-5641737174NAC domain-containing protein 19
3swp_B4e-5641737174NAC domain-containing protein 19
3swp_C4e-5641737174NAC domain-containing protein 19
3swp_D4e-5641737174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00496DAPTransfer from AT5G07680Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.0070s0003.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2280270.0AK228027.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-54-D06.
GenBankBT0064190.0BT006419.1 Arabidopsis thaliana At5g07680 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871283.10.0NAC domain-containing protein 79
SwissprotQ9FLR30.0NAC79_ARATH; NAC domain-containing protein 79
TrEMBLD7M0L40.0D7M0L4_ARALL; ANAC079/ANAC080/ATNAC4
STRINGfgenesh2_kg.6__736__AT5G07680.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.10.0NAC domain containing protein 80
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]