PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ZQX8T
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 433aa    MW: 47061.4 Da    PI: 6.8684
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ZQX8TgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.91.3e-34208262155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+rWtpeLHe+Fv+av+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Aradu.ZQX8T 208 KPRMRWTPELHEAFVDAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 262
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.169205265IPR017930Myb domain
SuperFamilySSF466893.76E-18206262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-32207264IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-25208262IPR006447Myb domain, plants
PfamPF002496.8E-10210261IPR001005SANT/Myb domain
PfamPF143794.8E-24294339IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MEARPSISIE RSSAEKHNVM GMSGALSSSL AVLPTPLEET YNKLPDSPLA FVEEGLMSGP  60
LTHSGHLNNN GAVGHIFSSS PGYSTALHHS SLSPHEKHSR NAHIISHSST NMATLPPFSS  120
NSGPLPSKPS RHFPNENSAS WHTDSVPSFL DFPANTSIDS GREPFQVSKP SLQLPGHPSE  180
GHQQLPASSE ENCAGAAPSS SAKSAPSKPR MRWTPELHEA FVDAVNQLGG SERATPKGVL  240
KLMKVEGLTI YHVKSHLQKY RTARYRPDSS EGVSEKKTSS IEEMASLDLR TGIDITEALR  300
LQMVVQKQLH EQLEIQRNLQ LRIEEQGRYL QMMFEKQCKP ETEMFKASLS TAENPSGSSL  360
DAMQDVPAKS ASMVDNYKPG PDQAIGSTKV VEGSVEIGGK HDSPKTQLSE NPKQHANAND  420
DAAQASKRQR KDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-31208266260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.ZQX8T
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5737241e-150AB573724.1 Lupinus albus LaMYB-CC5 mRNA for MYB-CC transcription factor, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182990.10.0protein PHOSPHATE STARVATION RESPONSE 1 isoform X1
RefseqXP_016182991.10.0protein PHOSPHATE STARVATION RESPONSE 1 isoform X1
RefseqXP_025632529.10.0protein PHOSPHATE STARVATION RESPONSE 1 isoform X1
SwissprotQ8GUN53e-75PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A445AFC80.0A0A445AFC8_ARAHY; Uncharacterized protein
STRINGGLYMA13G18805.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-72G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]