PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ZN6CN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 570aa    MW: 63441.1 Da    PI: 6.6125
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ZN6CNgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.41.4e-27327381156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k +++WtpeLH++Fv+aveqL G ++A+P++il+lmkv+gLt+++v+SHLQkYR++
  Aradu.ZN6CN 327 KMKIDWTPELHKKFVKAVEQL-GLDQAIPSRILDLMKVEGLTRHNVASHLQKYRMH 381
                  5689*****************.********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.99E-514106IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.4E-1214182No hitNo description
PROSITE profilePS5011016.34917158IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129413.336324383IPR017930Myb domain
SuperFamilySSF466895.38E-18325384IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-27325384IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24327382IPR006447Myb domain, plants
PfamPF002495.5E-8332379IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MPINDLQQWK DFPKGLKVLL LEGDATSAAE IKPKLEAMDY NVSAFCDENE ALSAISSRSE  60
SFHIAIVEVS INSGQGGFKF LENAKDLPTI MTSNDHCLST MMKCIACFIK LAHFHVCSAC  120
DAQLLTLRFT LLFKLGAVEF LHKPLSEDKL RNIWQHVVHK AFNASASVMS ESLKPVKESV  180
VSMLQLQTDN EQQESTYTDD DPDPGSDKYP APSTPQLNQG LRLMDDGDCP EQTNCSIEKE  240
SGEHDGEGES KSVETTCENL NSESNNPNEP MNTEKTLVKN LAEGSRDGNH DSSVYKHTND  300
KVLSSDDGNT KSSNKVDSCT LKAHRKKMKI DWTPELHKKF VKAVEQLGLD QAIPSRILDL  360
MKVEGLTRHN VASHLQKYRM HKRQILPKEE GRKWLNQRDQ MQRSYCLQQR PIMAFPPPNH  420
SNHTLSPAPV YPVWRQSGGQ AAAMPVWGPP GYPLWHPTES WHWKPLPGMH ADAWGCPVLP  480
PPQAPLPCFS YPLNVPGMHH TSAVDYKSIM PQSSLDLHLA EEVVDKVVKE AISKPWLPLP  540
LGLKPPSTDS VLAELSRKGI STIPPCSKGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-16329381355Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.ZN6CN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015959791.10.0two-component response regulator-like APRR2 isoform X2
SwissprotQ6LA431e-135APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A445ESI10.0A0A445ESI1_ARAHY; Uncharacterized protein
STRINGXP_007156636.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-126ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]