PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ZN23M
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 181aa    MW: 19680.3 Da    PI: 8.2462
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ZN23MgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY55.21.4e-177491759
                 T-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY 17 gsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 g+++prsY+rCt  gC+v+k+ver+++d k+v+itYeg+ +h+
  Aradu.ZN23M  7 GNHNPRSYFRCTNVGCTVRKHVERASHDLKFVIITYEGKQKHH 49
                 899************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-15751IPR003657WRKY domain
SMARTSM007741.8E-8750IPR003657WRKY domain
PROSITE profilePS5081121.161751IPR003657WRKY domain
PfamPF031065.0E-11748IPR003657WRKY domain
SuperFamilySSF1182907.06E-13751IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MMVISGGNHN PRSYFRCTNV GCTVRKHVER ASHDLKFVII TYEGKQKHHV PATCSSSHND  60
NATSQDKNDL FWSLFSTSVT QSGSFGCFFV NSEVRLLPLC NDLPFAHLGF WSTTPLVSQI  120
RSSGVAFIIS ITATAFPFPF AEASTVMLLL ASLATSPLKI GDGVEHPQSP PSSASFRQAP  180
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-147523378Probable WRKY transcription factor 4
2lex_A6e-147523378Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-20WRKY DNA-binding protein 33