PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.Z5BX3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 383aa    MW: 41940.1 Da    PI: 5.9318
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.Z5BX3genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.2e-33219277159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK vk+s++prsYYrCt++gC vkk+vers++dp++v++tYeg+H+h+
  Aradu.Z5BX3 219 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTSGCGVKKRVERSSDDPSIVVTTYEGQHTHP 277
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-35204279IPR003657WRKY domain
SuperFamilySSF1182904.18E-30211279IPR003657WRKY domain
PROSITE profilePS5081133.143214279IPR003657WRKY domain
SMARTSM007742.4E-40219278IPR003657WRKY domain
PfamPF031067.6E-28220277IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEEGKREKKK KEEEASTTTA TTITMANSVA FSDEIPITNT NTINTSYPFS SIFDMMPLPL  60
LPSYDHKTSA NGFIDLLALH DYTPSLFDCF PTTTTAAEAT PQQISSSQQQ QQALPSPASS  120
NVPDCSEVLN TPASPNSSSI SSSSNEGGAG VGSNNNNAEE HNGGKVVADD EHEAEDEEAD  180
GSKENQDKTK KQLKAKKKNQ KKQREPRFAF MTKSEVDHLD DGYRWRKYGQ KAVKNSPYPR  240
SYYRCTTSGC GVKKRVERSS DDPSIVVTTY EGQHTHPCPA TSRAALAFMH EPSFATIGSS  300
SPHFLLPHQQ HFQQPPPPPS LYNSATTTNP TPPTNASSFG TFVLQDGAFA AASRLNMDQA  360
FLRDHGLLQD IVPSQIRKED NIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-292122801078Probable WRKY transcription factor 4
2lex_A3e-292122801078Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1511REKKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015936896.10.0PREDICTED: probable WRKY transcription factor 48
TrEMBLI1MGD44e-97I1MGD4_SOYBN; Uncharacterized protein
STRINGGLYMA15G14860.25e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.15e-52WRKY DNA-binding protein 48