PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.YD7VI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 696aa    MW: 76466.9 Da    PI: 6.2782
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.YD7VIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.31.7e-28231284155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Aradu.YD7VI 231 KPRVVWSVELHQQFVAAVDQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 284
                  79*******************.********************************8 PP

2Response_reg60.41e-20351611109
                   EEEESSSHHHHHHHHHHHH.....HTTC............EEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEE CS
  Response_reg   1 vlivdDeplvrellrqale.....kegy............eevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvt 78 
                   vl+vdD+p+ +++l+++l+     ++++              ++ + ++e+al+ll++++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++
   Aradu.YD7VI  35 VLVVDDDPTCLMILEKMLRtclyeEARFvvltlfqevrafAAITKCNTAEKALTLLRKNKngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMS 130
                   68888888888888888877765555553333332222224455566777777777666699**********************6654.8******* PP

                   STTTHHHHHHHHHTTESEEEESS--HHHHHH CS
  Response_reg  79 ahgeeedalealkaGakdflsKpfdpeelvk 109
                   a + ++ + + +  Ga d+l Kp+ +e+l +
   Aradu.YD7VI 131 ADDGKNVVMKGVTHGACDYLIKPVRIEALKN 161
                   ***************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.8E-17310688IPR017053Response regulator B-type, plant
SuperFamilySSF521721.21E-2932174IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.0E-3832195No hitNo description
SMARTSM004482.5E-2233163IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011038.10934167IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.1E-1835161IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.51E-2336166No hitNo description
PROSITE profilePS5129411.518228287IPR017930Myb domain
SuperFamilySSF466896.81E-20228288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-30230289IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-25231284IPR006447Myb domain, plants
PfamPF002493.0E-7233283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MNLSNGRGSM STVTSGAAVK SADAVSDQFP AGLRVLVVDD DPTCLMILEK MLRTCLYEEA  60
RFVVLTLFQE VRAFAAITKC NTAEKALTLL RKNKNGFDIV ISDVHMPDMD GFKLLEHIGL  120
EMDLPVIMMS ADDGKNVVMK GVTHGACDYL IKPVRIEALK NIWQHVVRKR KNEWRDTEQS  180
GSAEEGDRQQ KASDDADYSS SANESNWRNS KKRRDEEEEA EERDDTSTLK KPRVVWSVEL  240
HQQFVAAVDQ LGIDKAVPKK ILELMNVPGL TRENVASHLQ KYRLYLRRLS GVSQHQNNMN  300
SSFMNPQDAT FGTISSINGI DLQTLAAAGQ LPAQSLATLQ AAGLGRSAPK GGLPMPIMDQ  360
RNLFSFENPR LRFTEGQQQQ QHLSNSKPVN LLHGIPTNME PKQLASLHQS SQPLGNMTVR  420
VNASTQSNPL LMQMAQSQPR GHMLSENTGP HLPRLPSSLG QPSASNGTSN ALMGRNGIAG  480
STRAPGYNPI SQSSSMMNFP INQTTEMPIS SFPLGSTPGI SSITTKGSFQ EEVTSGIKRA  540
GGFVPNYDIF SELQKPHDWE VSNPSLTYNA ASQHANPLHG NIDVSPSVLV QQSFSSNQQT  600
GQSRDANTMI VKPIFSASES MEQGTLQNQH LNTLVTDNSI RVKTERIPDA SSQTNFYPEH  660
YGQEDLMSAL LKQQEGIGPA ENDFDFDGYS LDNVPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-23230290464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015937402.10.0PREDICTED: two-component response regulator ARR1-like
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLI1KMU80.0I1KMU8_SOYBN; Uncharacterized protein
STRINGGLYMA07G37220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1