PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.Y7NUP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 330aa    MW: 37404.4 Da    PI: 6.4221
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.Y7NUPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.73e-291769153
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                 kprl+WtpeLH+rF+ea++qLGGsekAtPk+++++m+++gLtl+h+kSHLQ +
  Aradu.Y7NUP 17 KPRLKWTPELHQRFIEAINQLGGSEKATPKSLMRVMGIPGLTLYHLKSHLQAF 69
                 79*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-261569IPR009057Homeodomain-like
SuperFamilySSF466895.55E-141670IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-201769IPR006447Myb domain, plants
PfamPF002493.2E-71967IPR001005SANT/Myb domain
PfamPF143793.6E-22151198IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MENVQSSMHL ILSTDAKPRL KWTPELHQRF IEAINQLGGS EKATPKSLMR VMGIPGLTLY  60
HLKSHLQAFP FLLLAFTHSK YHGLLFFFFT NIFSVFFWSL QKYRLGKSQP QLEICSGNNK  120
HEDCREMKNS EGPCSSREES IGTQNEMTES MQIAEALQMQ MEVQKKLYEQ IEVQRHLQLK  180
IEAQGKYLQS VLHKAQETLA GMINNGSPGS PPISELTETR GGFSWSCGQR KQNRGTMCSL  240
EIESSLTSSE SSMDQRPNST NTTNTASLEL LPLFKESKEQ EDESIIGRKR SSSCCVDQPS  300
KMSRSELVSD IIDLNSEQID LNCSSSFWEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-191669154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.Y7NUP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1373631e-57BT137363.1 Medicago truncatula clone JCVI-FLMt-17O6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015956918.10.0myb family transcription factor PHL8 isoform X1
RefseqXP_025690777.10.0myb family transcription factor PHL8 isoform X1
TrEMBLA0A444ZV050.0A0A444ZV05_ARAHY; Uncharacterized protein
STRINGXP_007158649.11e-102(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.12e-65G2-like family protein