PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.Y0UPL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 124aa    MW: 14808.8 Da    PI: 8.0744
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.Y0UPLgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.75e-3345103159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  Aradu.Y0UPL  45 LDDGYRWRKYGQKSVKNSMYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 103
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-3135103IPR003657WRKY domain
SuperFamilySSF1182905.1E-2940104IPR003657WRKY domain
PROSITE profilePS5081128.48340105IPR003657WRKY domain
SMARTSM007741.7E-3845104IPR003657WRKY domain
PfamPF031062.2E-2646103IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MMMMQNPLVQ ENIDWVSFFS NEQNNNLFIG DNHNTNKETM EYDILDDGYR WRKYGQKSVK  60
NSMYPRSYYR CTHHTCNVKK QVQRLSKDTS IVVTTYEGIH NHPCEKLMET LTPLLKQMQF  120
LASF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26391021174Probable WRKY transcription factor 4
2lex_A2e-26391021174Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00317DAPTransfer from AT2G46130Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015947794.14e-68PREDICTED: probable WRKY transcription factor 43
SwissprotQ8GY112e-51WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBLK7MEZ21e-56K7MEZ2_SOYBN; Uncharacterized protein
STRINGGLYMA16G03480.23e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32273471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.19e-53WRKY DNA-binding protein 43