PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.XZ249
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 66aa    MW: 7650.13 Da    PI: 11.4306
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.XZ249genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.74e-26251251
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                 prl+Wtp+LH +Fv+av++LGG+e+AtPk +l+l +v gL++ h kSHLQ
  Aradu.XZ249  2 PRLCWTPNLHLSFVHAVQRLGGQERATPKLVLQLRNVRGLSIVHAKSHLQ 51
                 8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-21151IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-18252IPR006447Myb domain, plants
SuperFamilySSF466894.48E-11252IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MPRLCWTPNL HLSFVHAVQR LGGQERATPK LVLQLRNVRG LSIVHAKSHL QVAIRFYSLI  60
ILYFEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-16351351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16351351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16351351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16351351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.XZ249
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020977379.12e-27probable transcription factor KAN4
SwissprotQ700D98e-19MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A445ESD74e-27A0A445ESD7_ARAHY; Uncharacterized protein
STRINGAquca_021_00207.12e-25(Aquilegia coerulea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.15e-25G2-like family protein