PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.XE5AY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 170aa    MW: 19202.8 Da    PI: 4.8208
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.XE5AYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.79.9e-33110168159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYG+K+vk+s++pr+YYrCt  gCpvkk+ver++edp++v++tYeg+H+h+
  Aradu.XE5AY 110 LDDGYRWRKYGKKMVKNSPNPRNYYRCTVDGCPVKKRVERDREDPTYVITTYEGNHTHP 168
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-3596168IPR003657WRKY domain
SuperFamilySSF1182904.97E-29103169IPR003657WRKY domain
PROSITE profilePS5081131.295105170IPR003657WRKY domain
SMARTSM007745.9E-38110169IPR003657WRKY domain
PfamPF031066.1E-26111168IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MSSDKNKKAA DSPESGDSSN QWFFELSDYL KLNDDDDQWP DDDNVPPPLP EAEPLFFPNT  60
NEVGDFGASG SSGSNHLQGS SNAREVSGSE KKDASRERVA FKTKSEVEIL DDGYRWRKYG  120
KKMVKNSPNP RNYYRCTVDG CPVKKRVERD REDPTYVITT YEGNHTHPTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26100167774Probable WRKY transcription factor 4
2lex_A2e-26100167774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015934926.11e-124PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ54e-45WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A0B2RRJ97e-57A0A0B2RRJ9_GLYSO; Putative WRKY transcription factor 50
TrEMBLK7MND87e-57K7MND8_SOYBN; Uncharacterized protein
STRINGGLYMA17G34210.22e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.13e-44WRKY DNA-binding protein 50