PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.X1PQU
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 308aa    MW: 34248.1 Da    PI: 5.2794
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.X1PQUgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.23.8e-40191181100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k l+++e+++am+++++++++ra+dPv G+++++++lq q+e + ael+l+ 
  Aradu.X1PQU  19 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKVLNPHEKDEAMKTIIFQSDMRAKDPVGGCYRMVQDLQAQIEFHLAELELVL 116
                  7*********************************************************************************************9987 PP

       DUF260  99 ee 100
                  ++
  Aradu.X1PQU 117 QQ 118
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.04818119IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3619114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSSNSTITT RTGNSTTQAC AACKYQRRKC APDCILAPYF PHDRQRQFLN AHKLFGVSNI  60
TKIIKVLNPH EKDEAMKTII FQSDMRAKDP VGGCYRMVQD LQAQIEFHLA ELELVLQQLA  120
ILRAQAQHQQ AQHLYNQTAT SNINVSVNGD DSINSDPLTL YSSGGSGGLV VGGNGINHYH  180
YLQQMPHQDQ YMMVQEVNDS SSNNGTPLQE HANMWSMQNS LSSLSLQGQN SNCSVGDEYD  240
HKPMLDMASD DRNELGFEPQ DLVQRSDEAV LFKIDDAVIK AETDCFQQVQ DHDLKGAATL  300
FTLTNCTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-272012312113LOB family transfactor Ramosa2.1
5ly0_B4e-272012312113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.X1PQU
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015938723.10.0LOB domain-containing protein 22
TrEMBLA0A445BNZ10.0A0A445BNZ1_ARAHY; Uncharacterized protein
STRINGXP_007135547.11e-126(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-48LOB domain-containing protein 22