PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.X16AU
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 396aa    MW: 43754.7 Da    PI: 10.6074
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.X16AUgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.13.9e-33188242155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+rlrWt+eLH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Aradu.X16AU 188 KQRLRWTSELHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 242
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.599185245IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-32187243IPR009057Homeodomain-like
SuperFamilySSF466892.33E-17188242IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-26188243IPR006447Myb domain, plants
PfamPF002497.2E-8190241IPR001005SANT/Myb domain
PfamPF143791.1E-23277322IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MLKKVFAPHV PHGWDPPRRL TTTSVLKRRR LFNAEAPQQL ALSFSLSRFQ SFPGRQKRLQ  60
KTRVSISHTR SQSRISLDFL PKIPPKLVNT ALHTSEAPPP SSGDSIRLPL VYWVSSISPQ  120
TLLNPLRARI RLYNFESLAT MYHAKKFSSA TMVPHKPQGG GEQVGNVGVL DGSAVRNAGP  180
ASSGGNGKQR LRWTSELHDR FVDAITQLGG PDRATPKGVL RVMGVPGLTI YHVKSHLQKY  240
RLAKYLPDSP ADGKDSKDEK RTSGDTVTGI DSSQGLQIND ALRMQMEVQK RLHEQLEVQK  300
QLQMRIEAQG KYLQKIIEEQ QKLGSTLTNS DTLPLSHDKQ NNPPSEPSGS SDAIADSMSP  360
LKKQRIDDGS KDGFAASQVT TKTSQKTDCS VDQLDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-23187245159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12630KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.X16AU
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015970719.10.0myb family transcription factor PHL7 isoform X1
RefseqXP_025605499.10.0myb family transcription factor PHL7 isoform X1
TrEMBLA0A445CRR80.0A0A445CRR8_ARAHY; Uncharacterized protein
STRINGXP_004493285.11e-151(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-75G2-like family protein