PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.WQ4BK
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 380aa    MW: 42505.1 Da    PI: 9.6162
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.WQ4BKgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like72.85e-23195239246
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  Aradu.WQ4BK 195 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHM 239
                  9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.59E-8192238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-19193239IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-14195238IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPTGN GTAKQQEVDL GFWKRALDSS RTSFSSSSSP SPSSSLPKPT  60
SYFDLSLSNP RPSPSSHYFN NTATTTPTNN HNLLFQSLQY YHHHHPLLQP QPQSQPHTLS  120
QELGFLRPIR GIPVYQNPPS LPFPQHHHHH HHLLEPSSPP TTANAGASTH HFQSQALMRS  180
RFLSRFPAKR SMRAPRMRWT TTLHARFVHA VELLGGHERA TPKSVLELMD VKDLTLAHMY  240
RTVKTTDRAA ASSGQSDVYD NRSSGDTSED IMFDINSPST RRSDLSVKQG RTDNNNNNNH  300
LNQDKEYRGL WSNSSREAWL HGKPKLDSVG NNVHSLEKEM DPKCVSYERI SDGSSSSNVS  360
ASTSPKKPNL DLEFTLGQPL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.WQ4BK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963257.10.0probable transcription factor KAN2 isoform X1
SwissprotQ9C6163e-83KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A444WVP70.0A0A444WVP7_ARAHY; Uncharacterized protein
STRINGXP_007158256.11e-149(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59683452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-69G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]