PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.WLB92
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 460aa    MW: 49609.4 Da    PI: 7.5924
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.WLB92genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.94.3e-33178234259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  dDgynWrKYGqK+vkgsefprsYY+Ct+a+Cpvkkkvers  +++++ i+Y+geHnh+
  Aradu.WLB92 178 DDGYNWRKYGQKQVKGSEFPRSYYKCTHASCPVKKKVERSL-NGHITAIIYKGEHNHQ 234
                  8****************************************.***************8 PP

2WRKY107.75.7e-34344402159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  Aradu.WLB92 344 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHD 402
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-29171236IPR003657WRKY domain
SuperFamilySSF1182908.89E-26175236IPR003657WRKY domain
SMARTSM007746.6E-36177235IPR003657WRKY domain
PfamPF031062.2E-25178234IPR003657WRKY domain
PROSITE profilePS5081123.617178236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-37329404IPR003657WRKY domain
SuperFamilySSF1182907.72E-30336404IPR003657WRKY domain
PROSITE profilePS5081138.836339404IPR003657WRKY domain
SMARTSM007741.3E-39344403IPR003657WRKY domain
PfamPF031062.9E-26345402IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MVGGGGNGER PPWKAANSGG GVEEQPPQRP SITLPTRGGG GGSMESLFGG GFSPGPMTLI  60
SSFFGGDDGN KSFSQLLAGA MASPTAAAGP SGLIDSPSAL FSSSQVPLGH QQALLAQVTS  120
QGTQLHSSMQ VQPQDSLQTM SATTSFAQVH AANTSNNNTN PHMVEPSSSS LNVDKPADDG  180
YNWRKYGQKQ VKGSEFPRSY YKCTHASCPV KKKVERSLNG HITAIIYKGE HNHQRPNRRS  240
KDAAMASSEG SNMQGNADYH HDHGTSANHP RMDAESSQAT GEHLSGTSDS EEVGDHENEV  300
DDKIVEPDPK RRNTEVTHSD PDSSHRTVTE PRIIVQTTSE VDLLDDGYRW RKYGQKVVKG  360
NPYPRSYYKC TTPGCNVRKH VERASTDPKA VITTYEGKHN HDVPAAKINS HTIANNSSSQ  420
FKSQNSNIPQ MHGFGSKGIG VNEQQQQPVA RLRLKEEQIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-44178405878Probable WRKY transcription factor 4
2lex_A3e-44178405878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015965505.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ701e-135WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLI1J5V40.0I1J5V4_SOYBN; Uncharacterized protein
STRINGGLYMA01G06550.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-125WRKY DNA-binding protein 3