PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.WHH4F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 470aa    MW: 51318.8 Da    PI: 5.5691
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.WHH4FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.71.5e-34246300155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+rWtpeLHe+Fv+av+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Aradu.WHH4F 246 KPRMRWTPELHEAFVDAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 300
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.714243303IPR017930Myb domain
SuperFamilySSF466895.91E-18244300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-32245302IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-25246300IPR006447Myb domain, plants
PfamPF002497.7E-10248299IPR001005SANT/Myb domain
PfamPF143792.9E-26331378IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MKAHPAKQLN NMGMSGALPS SLAGLPPSLE DTYSKLSDSQ PTFVENELTT RPFTHSSSSG  60
VVGPMFSSSP GYSTDLHHSS LSPHDKQSKN THFLSPTFGN IASLPLPYSS NNGPIPSTTP  120
THYSKGNSAS WHGDSLNSFL DLPTSNPIDR SQVESSACNI MASEDYSKQN NWQEWADQLI  180
SDDDTLTSNW NDILVDNIQD LEPKVVFQVP KSSSQFPAGH QQLPASSGEN HVGATPSSSA  240
NSAPAKPRMR WTPELHEAFV DAVNQLGGSE RATPKGVLKL MKVEGLTIYH VKSHLQKYRT  300
ARYRPESSEG SSEKKLGTIE EMPSLDLKTG IEITEALRMQ MEVQKRLHEQ LEIQRNLQLR  360
IEEQGRYLQM MFEKQCKSGG IEPFKASSSA IDSTSGVSSD AMKDSPAKSE MEATPVDLCS  420
SEPHQANGNA TAEKKSLEVS GKQDAPEDPK QLASESEDSG HPPKRPRTDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-32245304160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.WHH4F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015968123.10.0protein PHOSPHATE STARVATION RESPONSE 1 isoform X1
RefseqXP_015968124.10.0protein PHOSPHATE STARVATION RESPONSE 1 isoform X1
RefseqXP_020981764.10.0protein PHOSPHATE STARVATION RESPONSE 1 isoform X1
TrEMBLA0A445CPT20.0A0A445CPT2_ARAHY; Uncharacterized protein
STRINGAES815720.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-89phosphate starvation response 1