PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.W2VKX
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 226aa    MW: 24559.3 Da    PI: 6.7421
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.W2VKXgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260105.35.1e-33785179
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgv 79
                 +CaaCk+lrr+C+++C++apyfpa++p++f++vh++FGasnv ++l+alp+++reda++s +++Aea +r PvyG++  
  Aradu.W2VKX  7 PCAACKFLRRECTPECIFAPYFPANNPERFECVHRVFGASNVGNILNALPPSQREDAAKSFAFQAEASLRSPVYGCTLQ 85
                 7***************************************************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.5736107IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-32785IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSSTPTPCAA CKFLRRECTP ECIFAPYFPA NNPERFECVH RVFGASNVGN ILNALPPSQR  60
EDAAKSFAFQ AEASLRSPVY GCTLQVPKRE PSASMNPQAI QGPFNPQEKP LSSPPAHLGP  120
PCGPNVVQYS AHLGPFKQEM LQAQELDLLQ AQELAAAKQV KMEVKMEPVA GIEPAAAAAP  180
YGGDIRRSEV NPVVALKLMF DNVMLTPKQS PFVLVLSQSI ERDIFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-327831187LOB family transfactor Ramosa2.1
5ly0_B8e-327831187LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.W2VKX
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025683011.11e-137LOB domain-containing protein 36
TrEMBLA0A445EXG61e-136A0A445EXG6_ARAHY; Uncharacterized protein
STRINGXP_007155957.15e-37(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-36LBD family protein