PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.VVL06
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 382aa    MW: 43659.3 Da    PI: 6.9847
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.VVL06genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-3299152255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtp+LH rFv+av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Aradu.VVL06  99 PRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 152
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.92995155IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2995153IPR009057Homeodomain-like
SuperFamilySSF466891.31E-1498153IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-2399154IPR006447Myb domain, plants
PfamPF002491.5E-9100151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MMMMMKMVEE ESHGSECSKT RSPCNDDNNN NEDDGYCEEE SETNNEEEVE EEDESSYKKQ  60
YKNNNGGGGG CSSNSTVEEN NEKKSSSTSV RPYVRSKLPR LRWTPDLHLR FVHAVQRLGG  120
QERATPKLVL QLMNIKGLSI AHVKSHLQMY RSKKVEDTNH QVVMADHHRL LIENGERNNV  180
YNLSQLPMLQ SYRYGHGYGV ASATLGVYEN MAHRNANLTH HHSIFSHNFG EQSSSHPHPP  240
HHHHHHEQKD HQFLSFGNGQ GSLCTNTNNN RLISSHIEKP RAQDFMPTNT NNNLKRKASE  300
NSDIDLDLSL KLNSRVVFND EKQLGRRSSM MMMMMMEEEE HHEVVVNSNL SLSLHSHQSS  360
SPQDHCNKVK GKKATTNLDL RI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.VVL06
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015961024.10.0transcription factor LUX-like isoform X1
TrEMBLA0A445DFA50.0A0A445DFA5_ARAHY; Uncharacterized protein
STRINGAES795496e-79(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.19e-46G2-like family protein