PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.VP5WD
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 354aa    MW: 39985.3 Da    PI: 9.5235
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.VP5WDgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-3186139255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtp+LH +Fv+av++LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Aradu.VP5WD  86 PRLRWTPDLHLSFVHAVQRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 139
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.31682142IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2982140IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1484140IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-2386141IPR006447Myb domain, plants
PfamPF002498.2E-987138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MSEGFEIHQE NNEGSGGGKS SNDNEGEENS FDLNEGAAMM SSDEELEEEN NNEEEGNSTN  60
PSSSSTASRE GKRGSGVRQY VRSKMPRLRW TPDLHLSFVH AVQRLGGQER ATPKLVLQLM  120
NVRGLSIAHV KSHLQMYRSK KLDDSGQVVR SERQRSKHEV GGVAYETMMK RSSPHQHFKM  180
GNGGIFLTTN YTTTTTPFSS LPHSSKPTNH HLWHLNHQIP SIRRPITPPL QTQLASRITP  240
MRPSRFLEEK KWPPFHHWKF KRLPNTNNIT LPSSHSSPFA TTSDFITFGD NTTTTIRDYL  300
SNSNTFKLNH QDKQLQHKEK QWVPDLQLGL SHHKDGDNND GTGTPEISTK LSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1787141357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1787141357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1787141357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1787141357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.VP5WD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015958155.10.0transcription repressor KAN1-like
TrEMBLA0A444ZRL30.0A0A444ZRL3_ARAHY; Uncharacterized protein
STRINGGLYMA08G12320.24e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-37G2-like family protein