PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.VDW04
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WOX
Protein Properties Length: 200aa    MW: 23159.7 Da    PI: 7.1968
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.VDW04genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.6e-21766357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++tkeq+  Le+l+++  r+psaee+++++++l    +++ ++V++WFqN++a++++
  Aradu.VDW04  7 SRWNPTKEQISMLENLYKQgIRTPSAEEIQQITARLraygHIEGKNVFYWFQNHKARQRQ 66
                 7*****************99**************************************97 PP

2Wus_type_Homeobox117.46.4e-38668365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++RW+Pt+eQi +Le+lyk+G+rtP++eeiq+ita+L++yG+ie+kNVfyWFQN+kaR+rqkq
        Aradu.VDW04  6 SSRWNPTKEQISMLENLYKQGIRTPSAEEIQQITARLRAYGHIEGKNVFYWFQNHKARQRQKQ 68
                       68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.37267IPR001356Homeobox domain
SMARTSM003893.9E-7471IPR001356Homeobox domain
SuperFamilySSF466892.35E-13473IPR009057Homeodomain-like
PfamPF000462.8E-19766IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.5E-9766IPR009057Homeodomain-like
CDDcd000862.05E-7868No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MEDGGSSRWN PTKEQISMLE NLYKQGIRTP SAEEIQQITA RLRAYGHIEG KNVFYWFQNH  60
KARQRQKQKQ HTLAYFNRSF LHHHHQPAVM CGPYCMVGTM RRIPDNNHSE DETMFDKQQD  120
RTLDLFPLHP TGILEGKKET QDNNNNNMMT MMCSFMAPSS SSSSDTTHDD GHGYRHQQQQ  180
LPFFDFFVTS GHGQGSFESG
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.VDW04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015952266.11e-152WUSCHEL-related homeobox 5-like isoform X1
RefseqXP_025686163.11e-152WUSCHEL-related homeobox 5-like
TrEMBLA0A445E4931e-151A0A445E493_ARAHY; Uncharacterized protein
STRINGGLYMA12G06895.13e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-36WUSCHEL related homeobox 2