PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.V8B24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 525aa    MW: 58062.5 Da    PI: 9.6591
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.V8B24genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.58.4e-264499459
                 SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  4 gynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 gy+WrKYG+K+v++s++pr+YY Ct  gC+vkk+ver  +dp+ v +tYeg H h+
  Aradu.V8B24 44 GYKWRKYGKKTVRNSPYPRNYYHCTAIGCNVKKRVERWLDDPTHVLTTYEGLHLHD 99
                 8*****************************************************96 PP

2WRKY90.31.5e-28290347259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +Dgy+WrKYG+K+v++s++pr+YYrCt+ gC+vkk+ver  +dp+ + +tYeg H h 
  Aradu.V8B24 290 EDGYRWRKYGRKTVRNSPYPRNYYRCTTIGCNVKKRVERWLDDPTHILTTYEGLHLHA 347
                  8******************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-2529101IPR003657WRKY domain
PROSITE profilePS5081127.22136101IPR003657WRKY domain
SuperFamilySSF1182903.53E-2337101IPR003657WRKY domain
SMARTSM007741.2E-2341100IPR003657WRKY domain
PfamPF031061.9E-184498IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.7E-28277349IPR003657WRKY domain
SuperFamilySSF1182903.4E-26282349IPR003657WRKY domain
PROSITE profilePS5081128.69284349IPR003657WRKY domain
SMARTSM007744.5E-30289348IPR003657WRKY domain
PfamPF031062.4E-21290346IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MRLKLRPSTM TSIAATTRIN RRSQNNLSKF ACLTESESDN LRYGYKWRKY GKKTVRNSPY  60
PRNYYHCTAI GCNVKKRVER WLDDPTHVLT TYEGLHLHDL PPISSTLLKS FGFYNNCTTG  120
PKPHRGNCSC RCKMPLIDLV KEGDFGPSLY EWLGIAHEDA PPVKRPVKHP LCSFPPAAIV  180
LESSKTVEQS QNSSFSLIAS NLDVAVGNNN NCNRVSGIKR PAKSVVGDGG NQSLRSDDEP  240
GDEKINIITR LKLSPSTMTS IAATMKINRR SENNLPKLAF LTESESDNLE DGYRWRKYGR  300
KTVRNSPYPR NYYRCTTIGC NVKKRVERWL DDPTHILTTY EGLHLHALPP IPPTPFKSFS  360
LYKNCTTGPK PDGGSCSCRC KGAVTVAGAG ADAGEQNRAN NAITSVHLRT VSGGSGVNDG  420
GSQRIVAGEN EFNYNKHMQN VEKAITPILL QNFKLIAPQT FLNNATPMTV TNNGHYQSSL  480
MSSVHHGNNH RQDCFGAGSS NGGAEDSFRK KSTGTGLLED IVNFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-24343491077Probable WRKY transcription factor 4
2lex_A8e-24343491077Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015959482.10.0PREDICTED: probable WRKY transcription factor 4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3032522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-32WRKY DNA-binding protein 48