PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.V6U4I
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 467aa    MW: 52014.2 Da    PI: 6.1979
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.V6U4IgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY87.99e-28182240160
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  l+DgynWrKYG K  kg e+prsYYrC  ++C++kkkv r+  d+k++ i+Y+g+Hnh+k
  Aradu.V6U4I 182 LNDGYNWRKYGEKRTKGGENPRSYYRCGEPNCTMKKKVGRNL-DGKIIAIMYKGNHNHPK 240
                  58****************************************.***************85 PP

2WRKY100.78.5e-32322380159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++pr+YY+C s+gC+vkk+ver+a+d k v +tYeg+Hnh+
  Aradu.V6U4I 322 LDDGYRWRKYGQKVVKGNPNPRNYYKCVSPGCNVKKHVERAADDIKSVMTTYEGKHNHD 380
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.2E-24176241IPR003657WRKY domain
PROSITE profilePS5081122.022177241IPR003657WRKY domain
SuperFamilySSF1182904.05E-21181241IPR003657WRKY domain
SMARTSM007748.0E-26182240IPR003657WRKY domain
PfamPF031066.3E-21183239IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-35307382IPR003657WRKY domain
SuperFamilySSF1182904.58E-28314382IPR003657WRKY domain
PROSITE profilePS5081136.46317382IPR003657WRKY domain
SMARTSM007747.2E-36322381IPR003657WRKY domain
PfamPF031065.9E-24323380IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MSFTTFSGLL SRRYNNTSMV DDNCWETCIP RTGDDNHGEF FSSIIYPSYS DFPPGFNPNE  60
FLDAFLSESN SLNWRNSSSE NQQSKEVEEK YYSDPSTDVS LLQSSSNIFE EGDPQRKQDT  120
FTILESGMLV DFSSPMTNTT NFQDPYLRNF SEMALAVPEI HSTLAPQLNC HKSINEDEDG  180
DLNDGYNWRK YGEKRTKGGE NPRSYYRCGE PNCTMKKKVG RNLDGKIIAI MYKGNHNHPK  240
PSKPVGSANV PLVNELYASS YTDSGNLNQQ SVGGGVENQL GAHTKRLKGG NGIYSYLFNP  300
SGGRAIKEPR VVVQTTTEID ILDDGYRWRK YGQKVVKGNP NPRNYYKCVS PGCNVKKHVE  360
RAADDIKSVM TTYEGKHNHD VPQERSSFAS RIASLTNNFA TPSSSSSPSL HDTSLSLSSP  420
RANNENQASQ ELTTLPFIVG IPNFGRSLIG TSYANEGPSS NNEEKKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36182382878Probable WRKY transcription factor 4
2lex_A1e-36182382878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015950534.10.0PREDICTED: probable WRKY transcription factor 26 isoform X1
SwissprotQ8S8P52e-68WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0B2SKP51e-104A0A0B2SKP5_GLYSO; Putative WRKY transcription factor 33
STRINGGLYMA01G31921.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3032322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.14e-70WRKY DNA-binding protein 26