PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.V0F31
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 316aa    MW: 34989.3 Da    PI: 6.5895
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.V0F31genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.8e-343387155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 k+rlrWt++LHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Aradu.V0F31 33 KQRLRWTNDLHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 87
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7463090IPR017930Myb domain
SuperFamilySSF466891.15E-173287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-323288IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-263388IPR006447Myb domain, plants
PfamPF002494.5E-93586IPR001005SANT/Myb domain
PfamPF143791.7E-23119165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MYHPNNSLVC DHPMDCVATA MDLVNGGNSL ASKQRLRWTN DLHERFVDAV AQLGGPDRAT  60
PKGVLRVMGV QGLTIYHVKS HLQKYRLAKY LPDSSTDGKN AEKKETEDVL SNLDGSSGMQ  120
ITEALKLQME VQKRLHEQLE VQRQLQLRIE AQGKYLKKII EEQQRLGGVL IEAPDWGATA  180
LVTGVTRQED NKTHQATPAT TSESPFLEVA VKEQALAKSL SIDESFSSQH EPLTPDSGCH  240
VGNPTGGPEE ERSTKKQRLN IDGSYSRPEM LLPHQILESN VSSNKQPNVF STPQEEYDHS  300
MGIAAKSVTR NSSRVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-243390158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-243390158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-243390158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-243390158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.V0F31
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015940282.10.0myb family transcription factor PHL7 isoform X1
RefseqXP_015940285.10.0myb family transcription factor PHL7 isoform X1
RefseqXP_015940289.10.0myb family transcription factor PHL7 isoform X1
RefseqXP_015940293.10.0myb family transcription factor PHL7 isoform X1
RefseqXP_025613840.10.0myb family transcription factor PHL7
RefseqXP_025613848.10.0myb family transcription factor PHL7
SwissprotQ9SJW01e-115PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A445AYF30.0A0A445AYF3_ARAHY; Uncharacterized protein
STRINGVIT_00s0475g00040.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF86103343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-101G2-like family protein