PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.U68KB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 226aa    MW: 24885.4 Da    PI: 7.152
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.U68KBgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.9e-43561551100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la+++
  Aradu.U68KB  56 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPENQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQLAKAQ 153
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Aradu.U68KB 154 AE 155
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.10555156IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-4356153IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEYKLNSSSS IPIIHVPTKI SNSPPPPSSS PPPISQSQSP TSCAPPSPPP PVVVSPCAAC  60
KILRRRCVEK CVLAPYFPPT DPLKFTIAHR VFGASNIIKF LQELPENQRA DAVSSMVYEA  120
NARIRDPVYG CAGAICQLQK QVSELQAQLA KAQAELVNMH CQQTNLVALI CMEMSTSNTH  180
QSSSHQEQHH MMMIQPQNNN NNNNHVDMSC FIDDNNLASA WEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-44471672122LOB family transfactor Ramosa2.1
5ly0_B8e-44471672122LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.U68KB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015942427.11e-166LOB domain-containing protein 1
SwissprotQ9LQR03e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A445BD211e-129A0A445BD21_ARAHY; Uncharacterized protein
STRINGAES622283e-94(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-54LOB domain-containing protein 1