PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.U0BF0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 229aa    MW: 25293 Da    PI: 9.4618
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.U0BF0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.51.7e-41431421100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i++lq+q+++l+ael++++
  Aradu.U0BF0  43 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPECQRADAANSLVYEANVRLRDPVYGCMGAISTLQHQVQSLQAELNAVR 140
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Aradu.U0BF0 141 SE 142
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.74742143IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4143140IPR004883Lateral organ boundaries, LOB
PRINTSPR000491.6E-5125141IPR017987Wilm's tumour protein
PRINTSPR000491.6E-5175189IPR017987Wilm's tumour protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MSRERERFEE IGKKIKREGD NVSSQMGRRH MLGPPGTLNT ITPCAACKLL RRRCAQECPF  60
SPYFSPHEPQ KFASVHKVFG ASNVSKMLME VPECQRADAA NSLVYEANVR LRDPVYGCMG  120
AISTLQHQVQ SLQAELNAVR SEILKYKLRE ANNNIIIPSS HHHLPMLPSS GSAVSVAAPP  180
PPPPPPPPPL PPNSLPPISS SSSSMYIQQQ QRPPTNYSRI PSDNISYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-45351503118LOB family transfactor Ramosa2.1
5ly0_B7e-45351503118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.U0BF0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015945145.11e-167LOB domain-containing protein 15
SwissprotQ8L5T51e-87LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A444X5531e-140A0A444X553_ARAHY; Uncharacterized protein
STRINGGLYMA06G15050.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-88LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]